SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002597 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOPRP00000002597
Domain Number - Region: 55-123
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00262
Family Transglutaminase, two C-terminal domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002597   Gene: ENSOPRG00000002830   Transcript: ENSOPRT00000002823
Sequence length 201
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4006:62687:67936:-1 gene:ENSOPRG00000002830 transcript:ENSOPRT00000002823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLTLSSCLGGSRKAGMRTMRLLALVAVALCAVTQAEEGARLLASKSLLNRYAVEGRDLTL
QYNIYNVGSSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGY
FNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIG
IPLLLWYSSKRKYDTPKPKKN
Download sequence
Identical sequences ENSOPRP00000002597 ENSOPRP00000002597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]