SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002605 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002605
Domain Number 1 Region: 4-238
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.85e-66
Family Proteasome subunits 0.000000000997
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002605   Gene: ENSOPRG00000002835   Transcript: ENSOPRT00000002831
Sequence length 239
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_760:45668:62504:1 gene:ENSOPRG00000002835 transcript:ENSOPRT00000002831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSIGTGYDLSLTFSPDGRVFVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEG
SNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHA
YTLYSAVRPFGCSFMLGSYSATDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQM
KEMTCRDVVKEVAKIIYIVHDEVKDKAFELELSWVGELPKGSHAIVPKDIREEAEKYAK
Download sequence
Identical sequences ENSOPRP00000002605 ENSOPRP00000002605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]