SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002617 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002617
Domain Number 1 Region: 22-142,175-354
Classification Level Classification E-value
Superfamily Phosphofructokinase 5.49e-93
Family Phosphofructokinase 0.000000878
Further Details:      
 
Domain Number 2 Region: 346-558
Classification Level Classification E-value
Superfamily Phosphofructokinase 5.62e-57
Family Phosphofructokinase 0.000068
Further Details:      
 
Domain Number 3 Region: 616-770
Classification Level Classification E-value
Superfamily Phosphofructokinase 0.000000000314
Family Phosphofructokinase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002617   Gene: ENSOPRG00000002817   Transcript: ENSOPRT00000002844
Sequence length 781
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_310:74932:135751:1 gene:ENSOPRG00000002817 transcript:ENSOPRT00000002844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVKVSSTPRGSYRKFLEQLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFI
YEGYQGMVDGGSNIVEANWESVSSILQVGGTIIGSARCKAFRTREGRLKAASNLVHRGIT
NLCVIGGDGSLTGANIFRKEWSSLLEELARDXXXXXXXXXXXXXXXXXXXXXXXXXXFCG
TDMTIGTDSALHRIIEVVDAIMTTAQSRDFVLVMGRHCGYLALVSALACGADWVFLPESP
PEEGWEESMCVKLSENRARKKRLNIIIVAEGAIDTQNRPITSEKIKELVVTQLGYDTRVT
ILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPETPACVVSLSGNQAVRLPLMECVQM
TQDVQKAMDERRFKDAVQLRGRSFETNLNTYKRLAIKLPDDQIPKTNCNVAVINVGAPAA
GMNAAVRSAVRVGIADGHKMFAVYDGFDGFAKGQIKEIGWGDVGGWTGQGGSILGTKRIL
PGKYLDKIATQIRTHNINAVLIIGGFEAYLGLLELSAAREKYEEFCIPMVMVPATVSNNV
PGSDFSIGADTALNTITDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGKGVFD
CRKNVLGHMQQXXXXXXXXXXXXXXISARAMRWISTKLKEAPGKAETVVSDDSICVLGIS
KRNVVFQPVTELKKETDFEHRIPKEQWWLKLRPVMKILAKYRTSYDVSDSGQLEPVQQQN
V
Download sequence
Identical sequences ENSOPRP00000002617 ENSOPRP00000002617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]