SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002639 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002639
Domain Number 1 Region: 43-81
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000127
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 2 Region: 119-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000293
Family EGF-type module 0.017
Further Details:      
 
Domain Number 3 Region: 81-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000436
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002639   Gene: ENSOPRG00000002880   Transcript: ENSOPRT00000002867
Sequence length 180
Comment pep:novel genescaffold:pika:GeneScaffold_5097:4802:48087:-1 gene:ENSOPRG00000002880 transcript:ENSOPRT00000002867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRMCKVLDFYVIIAIIKKYFWTLHLGPMFCYFCSNIGSDCEVNIDECLSEPCLHNGDCID
GVDRYTCDCQSGFFGTHCETNANDCFSNPCLHGRGIDLRNAYQCCEAEWTGTRCEVKITD
RTSIPCVNGGFSQKTVHRLTCICPLGYTGEYCEQSIRHEMNLALCLNGGILIAGPEHTFE
Download sequence
Identical sequences ENSOPRP00000002639 ENSOPRP00000002639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]