SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002734 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002734
Domain Number 1 Region: 124-184
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000128
Family Complement control module/SCR domain 0.00021
Further Details:      
 
Domain Number 2 Region: 23-82
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000764
Family Complement control module/SCR domain 0.0000624
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002734   Gene: ENSOPRG00000002976   Transcript: ENSOPRT00000002968
Sequence length 270
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3870:338916:379359:-1 gene:ENSOPRG00000002976 transcript:ENSOPRT00000002968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPCWLLWALASFVVVPGFRTELCDDPPMIQHATFRAITYKNGTMLNCECEKGFRRIKYG
SSYMLCTGNSSHSFWDNKCECVNSSIKNSERQVTTQPEEKTERKTTEMQSPMQPVDQEHP
LGDCREPPSWKHEATERIYHFIVGQVVHYQCLQGYRPIQREPAVSVCKMVCGKTQWTQPQ
LTCTNKSKHHQFPDKEEPQASMDDPLESETSCPITTDFQKHTEATTTMETFLFTMEYQVA
XXXXXXXXXXXXXXXXXXXXXXXKKSRRTI
Download sequence
Identical sequences ENSOPRP00000002734 ENSOPRP00000002734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]