SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002742 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002742
Domain Number 1 Region: 171-491
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.38e-80
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000396
Further Details:      
 
Domain Number 2 Region: 105-150
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000269
Family Anticodon-binding domain 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000002742
Domain Number - Region: 25-70
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000571
Family Anticodon-binding domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002742   Gene: ENSOPRG00000002960   Transcript: ENSOPRT00000002977
Sequence length 492
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1387:658:85211:-1 gene:ENSOPRG00000002960 transcript:ENSOPRT00000002977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSANASRKSQEKPREIDAAEDYAKERYGISSMIQSQEKPDRILVSVKDLTVQKADEVVW
VRGRIHTSRAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINKESIVDVEGVVR
KVNQKIGSCTQQDVELHVQKIYVISLAEPRLPLQLDDAIRPEVEGEEVGGATVNPDPRLD
NRVIELRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASDESNVTVSYFRYA
YDQSQLQMICADFEKVFCIGPVFRAEDSNTHRHLTEFVGLDIEMAFNYHYHEVMEEIADT
LVQIFKGLQERFQTEIQMVNKQFPCEPFKFLEPSLRLEYCEALAMLREAGVEMGDEDDLS
TPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNSYDMFMRGEEILSGA
QRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQT
SMFPRDPKRLTP
Download sequence
Identical sequences ENSOPRP00000002742 ENSOPRP00000002742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]