SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002785 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002785
Domain Number 1 Region: 12-138
Classification Level Classification E-value
Superfamily Hormone receptor domain 2.09e-29
Family Hormone receptor domain 0.00013
Further Details:      
 
Domain Number 2 Region: 124-406
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000137
Family Rhodopsin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002785   Gene: ENSOPRG00000003027   Transcript: ENSOPRT00000003023
Sequence length 442
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1815:231638:357831:-1 gene:ENSOPRG00000003027 transcript:ENSOPRT00000003023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAPALLPPALLTCCGWLLVPVSSIHPECRFHLEIQEEETKCAELLKAQTGKYKACSGVW
DNITCWRPADVGETVTVPCPKVFSNFYSKPGNISKNCTSDGWSEMFPDFIDACGYSDSED
ESKITFYILVKAIYTLGYSVSLMSLATGSIILCLFRKLHCTRNYIHLNLFLSFILRAISV
LVKDDILYSSSGTLHCPDQPSSWVGCKLSLVFFQYCIMANFYWLLVEGLYLHTLLVAIFS
PNRCFLAYLLIGWGIPTVCIGAWTAARLSLEDTGCWDTNDHSIPWWVIRIPILISIIXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXRLAKSTLLLIPLFGVHYMVFAVFPIGISSKYQ
ILFELCLGSFQGLVVAVLYCFLNSEVQSELKRKWRGLCPTQPRSRDYRLHGSSISRHGSE
SALQFHRGSRAQSFLQTETSVI
Download sequence
Identical sequences ENSOPRP00000002785 ENSOPRP00000002785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]