SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003013 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003013
Domain Number 1 Region: 180-577,658-663,694-736
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.02e-68
Family FAD-linked reductases, N-terminal domain 0.0000000000274
Further Details:      
 
Domain Number 2 Region: 562-670
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.5e-30
Family L-aminoacid/polyamine oxidase 0.000000845
Further Details:      
 
Domain Number 3 Region: 74-146
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000179
Family SWIRM domain 0.0000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003013   Gene: ENSOPRG00000003265   Transcript: ENSOPRT00000003283
Sequence length 759
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4618:455471:607231:1 gene:ENSOPRG00000003265 transcript:ENSOPRT00000003283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEYREMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGQAGG
LQDDSSGGYGDGQASGVEGAAFQSRLPHDRMTSQEAACFPDVISGPQQTQKVFLFIRNRT
LQLWLDNPKIQLTFEATLQQLEAPYNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKK
TGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARXXXXXXXXXXXXXXXXXXXXXXXXXXX
XGNPMAVVSKQVNMELAKIKQKCPLYEANGQAXXXXVPKEKDEMVEQEFNRLLEATSYLS
HQLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEYDELAETQGKLEEKLQELEA
NPPSDVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSC
VPVALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQ
PPAVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFL
FWNLYKAPILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRA
DPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHG
ALLSGLREAGRIADQFLGAMYTLPRQATPGVPAQQSPSM
Download sequence
Identical sequences ENSOPRP00000003013 ENSOPRP00000003013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]