SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003036 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003036
Domain Number 1 Region: 369-586
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.48e-37
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0022
Further Details:      
 
Domain Number 2 Region: 304-376
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000375
Family Domains B1 and B5 of PheRS-beta, PheT 0.016
Further Details:      
 
Domain Number 3 Region: 5-86
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000192
Family Domains B1 and B5 of PheRS-beta, PheT 0.0078
Further Details:      
 
Domain Number 4 Region: 218-257
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000314
Family B3/B4 domain of PheRS, PheT 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003036   Gene: ENSOPRG00000003292   Transcript: ENSOPRT00000003307
Sequence length 587
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3459:176515:303941:-1 gene:ENSOPRG00000003292 transcript:ENSOPRT00000003307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTVSVKRDLLFRALGRTYTDEEFDELCFEFGLELDEITSEKEIISKEQGNVKAKGASDV
VLYKIDVPANRYDLLCLEGLARSLQVFKEXXXXXXXXXXXXXXXXXXXXXXXXTAKVRPY
AVAALRNIKFTKDRYDSFELXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXTDNHLKHYLHIIENKPLYPVIYDSNGVVLSMPPIINGEHS
KLTVNTKNVFIECTGTDFTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEL
AYRKEIVRADLINKKVGIRETPESLAKLLTRMYLKSEVIGDGNQIEIEIPPTRADVIHAC
DIVEDAAIAYGYNNIQMTLPKTYTIANQFPLNKLTELLRHDMAAAGFTEALTFALXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXVARTTLLPGLLKTIAANRKMPLPLKLFEISDIVI
KDSTKDVGARNCRHLCAVYYNKNPGFEIIHGLLDRVMQLLAVPAGEDRAGYVIKAAAGPA
FFPGRCAEIFAKGQSIGKLGVLHPDVITKFELTMPCCSLEINIEPFL
Download sequence
Identical sequences ENSOPRP00000003036 ENSOPRP00000003036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]