SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003106 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003106
Domain Number 1 Region: 558-629
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.34e-19
Family Complement control module/SCR domain 0.0071
Further Details:      
 
Domain Number 2 Region: 184-246
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000102
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 311-366
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000202
Family Complement control module/SCR domain 0.00063
Further Details:      
 
Domain Number 4 Region: 372-427
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000013
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 5 Region: 500-555
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000944
Family Complement control module/SCR domain 0.00076
Further Details:      
 
Domain Number 6 Region: 251-305
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000134
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 7 Region: 132-192
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000306
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 8 Region: 69-126
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000118
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 9 Region: 16-73
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000996
Family Complement control module/SCR domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003106   Gene: ENSOPRG00000003388   Transcript: ENSOPRT00000003387
Sequence length 638
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2629:3445:35096:-1 gene:ENSOPRG00000003388 transcript:ENSOPRT00000003387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KFCDFPSVENGRIAQYYYTFKSFYFPMSIDKKLAFFCLAGYTTEAGKQEAQTKCTAQGWV
PEPRCFQKCTKPELRNGYISEAKLVYKVKESMRYGCASGYKTTGGEDQEVVQCLANGWSS
QPACRELQDTCLAPELYNGNYSKLQKTFKVKEKVQYECSPGYYTAGGKKTEEVECHSHGW
SLTPKCHKLSCSPLRLIENGYFHPVKQTYEEGDVVQFFCHENYHLSGSDLIQCYNFGWYP
ESPVCEGRRSRCPPPPMPLNSKTQTYSTAYRHGATIQIQCELNFEIQGPGEMRCESGKWT
EPPKCIEAKRVACAQPPVIENGAANMHSGTYSSGDTVTYKCDSGYHLRGTSAITCNHGKW
TALPECTANIEHCKPPPNITNGAVVDGLLTSYATGSSVEYRCNEYYLLRGPKMSRCEQGR
WSPPPVCLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXSSGMCASPPLIKHGVIISSIVGTYENGSSIEYKCFDNYFLQGSR
EAYCVEGKWTTPPMCLEPCTLSFVEMERNNLLLRWNFDNRPFIFHGEYVEFLCTRDTYIE
ESSVLGSRLRVQCVRGQLNYPRCIARRSQSYQESLRTQ
Download sequence
Identical sequences ENSOPRP00000003106 ENSOPRP00000003106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]