SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003109 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003109
Domain Number 1 Region: 27-179
Classification Level Classification E-value
Superfamily C-type lectin-like 4.71e-48
Family Sulfatase-modifying factor-like 0.000000312
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003109   Gene: ENSOPRG00000003386   Transcript: ENSOPRT00000003390
Sequence length 322
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2797:11572:68125:1 gene:ENSOPRG00000003386 transcript:ENSOPRT00000003390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AARHGLWPLLLVVLLSSPGLRLGNGQPAGMVQLRGGRFRMGTNARDRRAGEGPVREVSVS
PFAIDIVPVTNKDFREFVRGTKYRTEAETFGWSFVFEDLVSQELKNKTTRRLKNLLWWLP
VERAFWRQPAGPGSGIREKLELPVLHVSWNDARAYCAWRGKRLPTEEEWEFAARGGLKXX
XXXXXXXXXXXXXXXXXGKFTTGDTAEDDYRXXXXXXXXXXXXXXXWATLQIHPRTTSAS
AVLPMPAGPRESCEQPCQEPEGGPPGYLSFVITQPHARPSDSSPVVVGTSRQAREELTLL
WSMREWTPLTVAGSWELLPKAG
Download sequence
Identical sequences ENSOPRP00000003109 ENSOPRP00000003109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]