SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003113 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003113
Domain Number 1 Region: 3-51
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000063
Family C-type lectin domain 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000003113
Domain Number - Region: 159-238
Classification Level Classification E-value
Superfamily PKD domain 0.000235
Family PKD domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003113   Gene: ENSOPRG00000003293   Transcript: ENSOPRT00000003394
Sequence length 2350
Comment pep:novel genescaffold:pika:GeneScaffold_3748:320871:397112:-1 gene:ENSOPRG00000003293 transcript:ENSOPRT00000003394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGTWLDTFNWSYSIWRRGQVAPGPNTCGYIRRGFSWATSDCTQAFAFICEFGVGWRLACR
GLNATLHCGSGYVIQLQDAIYGRQTPHYCVQGTGQPSHLEEECTWVNVKDEVAGQCQGLQ
ACQVAADGSYFGDKCPTQGSYLWVQYQCQEGLQLAVSRDNVIFDNVTISLTWLLTPYVGN
LSCVISMGDGHTLDPYDPPSVSSSVTHQFTSPGEFIVFAECTTSEWHVTAEQRVVVREQV
ERLRVIGCSGLSMPGATPLCQAAFGDPLWIQVELEGGTEVTFHILLGNETLAESSVPSSS
LLCNLTLEWGAQAQLGPGEHHLEIQACSNATASIPPRNLTVRLLELLSGLRASWQSDHLQ
LGQDLVINVSVAHGTPEELIFKVAGPSATFSHKEESCRELFGTYRVAVPAAGTFLVTVLV
RNAFSNLSLEVGNITVTVPSNLQEPFGMNIEEQSKGKEGVEVSVDPSEYVDPFTIVTVGW
PDHNEDLHFQWSCGRCWAQWNDCVERHLLRTDQRELVVPPSCLPPPSSAVTMRLAITKGQ
ELDHKAEQCLYVSAARELKPQISCEHNCGPVNLHDSVLLRVIVGNASSAAMFSWYLDHTS
PEKAEPLPAACRLQGFWPRSLTLLQSNASTLLLNSSVLRAWGEVIRIRVTALTSSAYGED
TYVISTLPAPGVTACAIVPEVGTILTSFAILCNTSSTRGRLEHCFCLESGSCLHCGPEPA
LPSVYLPPGKEDNDFMLTVVISVTNQAGDRWQTQATAKVHIQDTPVEDMAFPAAMLERLT
TTLQDEGSPEQLLQLARSVSSALNQEGQGAGQLLRQDARQKVREHVLKSLSTVMASLEDM
QRVQGLAEALREVTHRSEELTSAAQRVASWALQQASEALLMMSAKTHPEDQRRQSASQNL
LQAAGNVLEASLSNSSEEPSGFSGSQAAPVAQLLRVVEQVQTALLLGMLPGGPPAMLETP
SISIYTNRIQPQTWRGCSVCIAAAGSATFTLPAAXXXXXXXXXXXXXXXXMASFPTSPFP
ARGRFDVTGTVAGLRLTHPGGQLIPVKNLPEHIEXXXXXXXXXXXXXXXXXLTGPGALRV
NVTSGQAALGIQLHWRPSIPLILSLGSGFHPNSTNYDIQIRLPPAAAPEELFTWLLAPED
LRFGEGVYYLTVAPESDLGLAPRGNLTVGVTTFLSHCVFWDEVQEIWDNSGCQXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXCSTLRASRLPRGLPWWCVLVGWLLVAATSGVAAFFTML
YGLHYGRATSLRWLLSMVVSFVESVFVTQPLKVLGFAAFFALVLKREEEEEEAVPLLLGH
LDGPGPYTLFRGRRRSSGAVYHPPPATTIMKLRTSRLQEQKAFALVREILXXXXXXXMML
LLLYGQRDSYHFNRHLEHSFIKFSAVLSFQEFFEWANTTLMSNLFSHPPGFITDGNSKLL
GSAQIRQVRVRDGSCPVAQQLQASLYGCHVPYSLQVEDLADYGEGWNASALNNGSTRARA
NVKDITHGGKSLCMEEEAMSPALIARMHQDRVLQYLFDNTWLDTLTRAVFVEFTVYNANV
NLFCLVTLTLETSALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGISFGETA
VTDAALGYIIAFLVLLSTVKLWHLLRLNPKLKLITMALRRAWGDISGFVLVVLLMLLAYS
FASNLLFGWQLRSYKTLLDAAETMISLQLGIFNYEEVLDSPVFGSFSRSCIVXXXXXXXX
XXXXXXXXXXXXXXXXXXPSEEREIMDLLLMKILSFLGMKCKNKDGTSSPELPSPPPKAL
ASPAPASLKV
Download sequence
Identical sequences ENSOPRP00000003113 ENSOPRP00000003113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]