SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003115 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003115
Domain Number 1 Region: 6-258
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.73e-92
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000557
Further Details:      
 
Domain Number 2 Region: 259-458
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 2.22e-61
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0000172
Further Details:      
 
Domain Number 3 Region: 597-760
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 6.02e-39
Family AlaX-like 0.035
Further Details:      
 
Domain Number 4 Region: 513-593
Classification Level Classification E-value
Superfamily Translation proteins 3.03e-16
Family AlaX-M N-terminal domain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003115   Gene: ENSOPRG00000003373   Transcript: ENSOPRT00000003396
Sequence length 966
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3219:30004:108710:-1 gene:ENSOPRG00000003373 transcript:ENSOPRT00000003396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFVLTASEIRQRFIDFFKRHEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPS
HPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKMALE
LLTQEFGIPIERLYVTYFXXXXXXXXXXXXXXXXXXXXXXLDDSRILPGNMKDNFWEMGD
TGPCGPCSEIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFIQYNREADGVLKPLPKKSIDT
GMGLERLVSVLQNKMSNYDTDLFMPYFEAIQKGTGARPYTGKVGVDDVDGIDMAYRVLAD
HARTITVALADGGRPDNTGRGYVLRRILRRAVRYSHEKLSASRGFFATLVDVVVQSLGDA
FPELKKDPDMVKDIINEEEMQFLKTLSRGRRILDRKIQSLGDCKIIPGDTAWLLYDTYGF
PVDLTGLIAEEKGLVVDMDGFEEERKLAQLKSQGKGAGGEDLIMLDIYAIEELRAKGLEA
TDDSPKYNYHADASGSYVFESTVATVLALRREKTFVEEVSTGQECGVVLDRTCFYAEQGG
QIYDEGYLVKADDSSEDKTEFTVKNAQVRGGYVLHIGTVYGSLKVGDQVRLFIDEPRRRP
VMSNHTATHILNFALRSVLGEADQKGSLVAPDRLRFDFTAKGAMSTQQIKKAEEIANEMI
EAAKPVYTQDCALAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSELLEDPSGPAGSLTSV
EFCGGTHLQNSSHAGAFVIVTEEAIAKGIRRIVAVTGAEAQKALRKAESLKKSLSLMEAK
VKAQTTPNKDVQKEIADLGEVLATAVIPQWQKDELREMLKSLKKIMDDLDRASKADVQKR
VLEKTKQVIDSNPNQPLVILEMESGASAKALNEALKLFKTHSPQTSAMLFTVDNEAGKIT
CLCQVPQNAANGLKASEWVQQVSGLMDGKGGGKDMSAQATGKNVGCLQEALQLATSFQLR
LGDVRN
Download sequence
Identical sequences ENSOPRP00000003115 ENSOPRP00000003115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]