SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003131 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003131
Domain Number 1 Region: 437-692
Classification Level Classification E-value
Superfamily SIS domain 4.82e-66
Family double-SIS domain 0.00000769
Further Details:      
 
Domain Number 2 Region: 115-207,261-305
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.00000182
Family Class II glutamine amidotransferases 0.016
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000003131
Domain Number - Region: 368-396
Classification Level Classification E-value
Superfamily SIS domain 0.00321
Family double-SIS domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003131   Gene: ENSOPRG00000003391   Transcript: ENSOPRT00000003412
Sequence length 692
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3920:287247:346486:-1 gene:ENSOPRG00000003391 transcript:ENSOPRT00000003412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFAYLNYHVPRTRREILETLIKGLQRLEYRGYDSAXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFIVIHN
GIITNYKDLKKFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXES
AFALVFKSVHFPGQAGRRGSPLLIGVRSEHKLSTDHIILYRTXXXXXGSKYSRWGSQGER
GKDKKGSCNLSRVDSTTCLFPVEEKAVEYYFASDASAVIEHTNRVIFLEDDDVAAVVDGR
LSIHRIKRTAGDHPGRAVQTLQMELQQIMKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXNLGGLKDHIKEIQRCRRLILIACGTSYHAGVAXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGP
EIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQ
KLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMP
VIMIIMRDHTYAKCQNALQQVVARQXXXXXXXXXXVTETINTKRTIKVPRSVDCLQGIIS
EIPLQFLAFLLAVLRGYDVDFPRNLAKSVTVE
Download sequence
Identical sequences ENSOPRP00000003131 ENSOPRP00000003131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]