SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003167 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003167
Domain Number 1 Region: 106-357
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.62e-64
Family Nuclear receptor ligand-binding domain 0.00000000352
Further Details:      
 
Domain Number 2 Region: 9-89
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.18e-26
Family Nuclear receptor 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003167   Gene: ENSOPRG00000003455   Transcript: ENSOPRT00000003450
Sequence length 357
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2628:65986:70044:-1 gene:ENSOPRG00000003455 transcript:ENSOPRT00000003450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSGEDEPRNCVVCGDRATGYHFHALTCEGCKGFFRRTVNKHPGLTCPFAGSCEVSRVQR
RHCPACRLHKCLAAGMRKDMIMSAEALALRRAKQAQRRAQQTPVQLSKEQKELVQILLGA
HTRHMGTMFEQFVHFKPPAYLFIHHQPSPALVPVLPLLTHIADINTYMVQQIIKFTKDLP
LFRSLLIEDQIYLLKGAAVEICHIILNTTFCLQTQNFFCGPLRYTMQDGAHVSPTVGFQK
EFLELLLRFHGTLRRLQLQEPEYVLMAAMALFSPALYLPDRPGITQREEINQLQEEMAFT
LDSYIKGQQPQPRDRFLYPKLLGLLVELRSIDNAYRYQIQHIQGLWALMPLLQEIYS
Download sequence
Identical sequences ENSOPRP00000003167 ENSOPRP00000003167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]