SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003185 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOPRP00000003185
Domain Number - Region: 254-342
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.00149
Family Gamma-glutamyltranspeptidase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003185   Gene: ENSOPRG00000003481   Transcript: ENSOPRT00000003470
Sequence length 350
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3219:175430:187388:-1 gene:ENSOPRG00000003481 transcript:ENSOPRT00000003470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCSLRVWFLSVAFLLVFIMSLLFTYSHHSMATLPYLDSGALGGTHRVKLVPGYAGLQRL
SKEGLTGKSCACRRCMGDAGTSDWFDSHFDSNISPVWTRENMDLPPDVQRWWMMLQPQFK
SHNTNEVLEKLFQIVPGENPYRFRDPHQCRRCAVVGNSGNLRGSGYGQDVDGHNFIMRMN
QAPTVGFEQDVGSRTTHHFMYPESAKNLPANVSFVLVPFKALDLLWIASALSTGQIRXXX
XXXXXXXXXXXXXVQIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVNVYGFG
ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN
Download sequence
Identical sequences ENSOPRP00000003185 ENSOPRP00000003185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]