SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003211 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003211
Domain Number 1 Region: 80-375,482-519
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.2e-42
Family FAD-linked reductases, N-terminal domain 0.0000581
Further Details:      
 
Domain Number 2 Region: 356-462
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.57e-26
Family L-aminoacid/polyamine oxidase 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003211   Gene: ENSOPRG00000003493   Transcript: ENSOPRT00000003497
Sequence length 579
Comment pep:known_by_projection scaffold:pika:scaffold_15090:6779:13731:-1 gene:ENSOPRG00000003493 transcript:ENSOPRT00000003497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPQDDFCPRLTSKAMGAERAPPRQLCTLRLLVLLPTLLSLAASLDWKAAPSPDPFAKCMH
DPDYEQLLKVVTLGLNRTLKPQKVIVVGAGVAGLVAAKVLSDAGHKVAILEADVVCGTRF
FTFWFQSSFQILHELCKSLGLNLTKFTQYDENTWTEVSEVKLRNYVVEKMPEKLGYNLRP
RERGRAPEEIYQMALNKALKDLKELGCKKAMRKFEKSTLLEYLLEEGNLSQPAARLLGDV
LSKDGFFYLSFAEALRAHSCLSDRLRYSRIVGGWDLLPRALLSSLSGXXXXXXXXXXXXX
XXXXXXXHIATSRRARNLKALTADVVLVTASGPALQRIAFTPPLSRKRQEALRGLHYVPA
TKVFLSFRRPFWHDEHIEGGHSNTDRPSRVIYYPPPGEGALLLASYTWSDAAAPFAGLSL
QQALRLALDDVAALHGPLVYRLWDGSGMIKRWAEDPHSQGGFVVQPPLLWQADLESGPEY
DWAVPYGRIYFAGEHTALPHGWVETAVKSALRAAMRINNRERHVHPMASSEEPATGLEEQ
GHAAVAASSPPCKGSKGGARRPSQHTLSPQHTTHKRASH
Download sequence
Identical sequences ENSOPRP00000003211 ENSOPRP00000003211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]