SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003273 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003273
Domain Number 1 Region: 322-604
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.44e-93
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000123
Further Details:      
 
Domain Number 2 Region: 231-321
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 6.8e-26
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0014
Further Details:      
 
Domain Number 3 Region: 606-713
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 6.64e-21
Family Anticodon-binding domain of Class II aaRS 0.0022
Further Details:      
 
Domain Number 4 Region: 83-143
Classification Level Classification E-value
Superfamily TGS-like 0.0000000000000126
Family TGS domain 0.0055
Further Details:      
 
Domain Number 5 Region: 146-191
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 0.0000000000196
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003273   Gene: ENSOPRG00000003544   Transcript: ENSOPRT00000003564
Sequence length 723
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1295:90095:135482:1 gene:ENSOPRG00000003544 transcript:ENSOPRT00000003564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEEAASSPSGRMGGEEKSEGAGEEKRKEGGKKKNKDGAGDGGRAELNPWPEYINTRLEM
YNKLKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIA
KVNKVVWDLDRPLEEDCTLELLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIE
NGFYYDMYLEEGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYNKFKCRIL
NEKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKTLKIHKNSSTYWEGKADMETLQRIYGI
SFPDPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNTLMEFI
RSEYRKRGFQEVVTPNIYNSRLWMTSGHWQHYSENMFSFEVEKELFALKPMNCPGHCLMF
DHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEMKGCL
DFLRTVYEVFGFSFKLNLSTRPEKFLGDIEVWNQAEKQLENSLNEFGEKWELNPGDGAFY
GPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVSHDGDDKKRPVIIHRAILGSVERM
IAILTENYGGKWPFWLSPRQVMVVPVGPTCDDYAQKXXXXXXXXXXXXXXXXXXXXXLNK
KIRNAQLAQYNFTLVVGEKEKASGTVNIRTRDNKVHGERTISETVERLQQLKQSRSKQAE
EEF
Download sequence
Identical sequences ENSOPRP00000003273 ENSOPRP00000003273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]