SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003277 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003277
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.6e-28
Family (Glycosyl)asparaginase 0.001
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000003277
Domain Number - Region: 178-231
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.00566
Family (Glycosyl)asparaginase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003277   Gene: ENSOPRG00000003583   Transcript: ENSOPRT00000003568
Sequence length 244
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3388:244:8724:1 gene:ENSOPRG00000003583 transcript:ENSOPRT00000003568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HGSVLNVNGEVEMDASIMDGKDLSTGAVSAVRGIANPIRLARLVMEKTPHCFLTHQGAAK
FAAEMGIPEIPGEKLVTERNKKHLEKEKQEKGAQRPDCQXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKTL
EEAAALSLGYMKTRLKGLGGLIAVNKTGDWAAKWTSTSMPWAAVKDGQLHFGIDLDDTKV
TELP
Download sequence
Identical sequences ENSOPRP00000003277 ENSOPRP00000003277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]