SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003291 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003291
Domain Number 1 Region: 379-484
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.7e-23
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.002
Further Details:      
 
Domain Number 2 Region: 208-301
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 6.54e-21
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000794
Further Details:      
 
Domain Number 3 Region: 85-142
Classification Level Classification E-value
Superfamily PH domain-like 1.22e-18
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000631
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003291   Gene: ENSOPRG00000003580   Transcript: ENSOPRT00000003582
Sequence length 484
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2798:124578:192823:-1 gene:ENSOPRG00000003580 transcript:ENSOPRT00000003582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGQQQQQPPPRRVTNVGSLLLTPQENESLFTFLGKKCVXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVAL
NFANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPSLPMATVDIKNPEITTNRFYGPQV
NNISHTKEKKKGKTKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDLC
GISEAQLKDRETSKVIYDFIEKTGGVEAVKNELKQAPLPPPSRAGPPPPPPPHSSGPPPP
PARGRGAPPPPPSRAPTAAPPPPPPSRSGAGVPPPPPNRVYPSPPPALPSSAPTGPPPPP
PPPLSGSAAPPPPPPPPPPPGPPPPPGLPSDGDHQVPSPAGSKAALLDQIREGAQLKKVE
QNSRPVSCSGRDALLDQIRQGIQLKSVSDGPDSAPPTPAPTSGIVGALMEVMQKRSKAIH
SSDE
Download sequence
Identical sequences ENSOPRP00000003291 ENSOPRP00000003291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]