SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003311 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003311
Domain Number 1 Region: 16-191
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.16e-40
Family Bee venom hyaluronidase 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000003311
Domain Number - Region: 254-270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0129
Family EGF-type module 0.067
Further Details:      
 
Domain Number - Region: 234-284
Classification Level Classification E-value
Superfamily Yeast killer toxins 0.0994
Family SMK toxin 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003311   Gene: ENSOPRG00000003610   Transcript: ENSOPRT00000003602
Sequence length 304
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2798:249348:258157:1 gene:ENSOPRG00000003610 transcript:ENSOPRT00000003602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REVSAADIELAKATFGSAKALMTETIKLGIKSRPKGLCGYYLYPDCHNYNIYAPNYTGSC
PEEEVLRNNELSWLWNSSAALYPSIGVRKSLGASENVLRFSRFRVRESLRVSAMTSQECS
LPVFVYTRLGYRDEPLFFLSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGNCTKVKRY
VSSDLGSYIVNVTRAAEVCSLHLCRNNGRCVRKMWKAPDYLHLNPASFHIEASEDDEFIV
KGKASDTDLAVMAEKFSCHCYQGYEGADCREMKTADGCPQVSPCSSSLIASLLLIVAGYQ
RIHL
Download sequence
Identical sequences ENSOPRP00000003311 ENSOPRP00000003311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]