SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003431 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003431
Domain Number 1 Region: 4-268
Classification Level Classification E-value
Superfamily SIS domain 4.45e-87
Family Phosphoglucose isomerase, PGI 0.000000000351
Further Details:      
 
Domain Number 2 Region: 356-397
Classification Level Classification E-value
Superfamily SIS domain 0.00000000000000283
Family Phosphoglucose isomerase, PGI 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003431   Gene: ENSOPRG00000003729   Transcript: ENSOPRT00000003732
Sequence length 397
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_963:318476:338449:1 gene:ENSOPRG00000003729 transcript:ENSOPRT00000003732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALTRNPQFQKLQQWHREHGAELKLRHLFDSDKERFNHFSLNLNTNHGHILVDYSKNLV
TEEVMHLLVDLAKSRGVEAARESMFNGEKINSTEDRAVLHVALRNRSNTPILVDGKDVMP
EVNRVLDKMKAFCQRVRSGDWKGYTGKTITDVINIGIGGSDLGPLMVTEALKPYSAGGPR
VWFVSNIDGTHIAKTLASLNPESSLFIIASKXXXXXXXITNAETAKDWFLMSAMDPAAVA
KHFVALSTNTAKVKEFGIDPQNMFEFWDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDMESN
GKYITKSGARVDHQTGPILWGEPGTNGQHAFYQLIHQ
Download sequence
Identical sequences ENSOPRP00000003431 ENSOPRP00000003431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]