SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003556 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003556
Domain Number 1 Region: 106-213
Classification Level Classification E-value
Superfamily C-type lectin-like 1.43e-24
Family C-type lectin domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003556   Gene: ENSOPRG00000003856   Transcript: ENSOPRT00000003865
Sequence length 215
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2898:118415:122310:-1 gene:ENSOPRG00000003856 transcript:ENSOPRT00000003865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAPLLTPLLLLVTVSALHLENDACLLKSLQLKEDQGQDLGCSGEQKGELFLTKEEIQSL
QEDDQDAFEDQEPMESSDLLLDDKLQCPKEEDTVLVQEVGCKTCRYVVVKSQEVFKELEA
VCKNCYRGNLVSIHNYNINRFIYRMASKSNQAQVWTGGYTKCWILWKKFRWIDGSSWNYS
NWPVKGSGRCVAMRTIDGRWQQASCSRKMPFVCLS
Download sequence
Identical sequences ENSOPRP00000003556 ENSOPRP00000003556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]