SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003568 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003568
Domain Number 1 Region: 120-201
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.67e-31
Family Nuclear receptor 0.00000886
Further Details:      
 
Domain Number 2 Region: 189-291
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.75e-22
Family Nuclear receptor ligand-binding domain 0.0000458
Further Details:      
 
Domain Number 3 Region: 400-443
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.000000000000275
Family Nuclear receptor ligand-binding domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003568   Gene: ENSOPRG00000003883   Transcript: ENSOPRT00000003879
Sequence length 449
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4723:1750:17656:1 gene:ENSOPRG00000003883 transcript:ENSOPRT00000003879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSSPVTSSPLNSPTGRGSMAAPSLHPSLGPGLGSALGSAGQLHSPINGMGPPFSVISPPV
GPHSMSVPTTPTLGFGTGSPQLNSPMNPVSSSEDIKPPLGLNGVLKVPTHPSGNMASFTK
HICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRY
QKCLAMGMKREAVQEERQRGKDRNESEVESTSSANEDMPVEKILEAELAVEPKTETYVEA
NMGLNPSSPNDPVIYICAADKQLFTLVEWAKRVPHFSELPLDDQVILLRAXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFAKLLLRLPALRSIGLKCL
EHLFFFKLIGDTPIDTFLMEMLEAPHQMT
Download sequence
Identical sequences ENSOPRP00000003568 ENSOPRP00000003568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]