SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003709 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003709
Domain Number 1 Region: 1-99
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 4.37e-16
Family (Glycosyl)asparaginase 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003709   Gene: ENSOPRG00000004034   Transcript: ENSOPRT00000004027
Sequence length 326
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4085:465656:559878:-1 gene:ENSOPRG00000004034 transcript:ENSOPRT00000004027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSPFTNAGMGSNLNLLGEIECDASIMDGKSLNFGAVGALSXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXFLVGEGAYRWAVDHGIPSCPPNIMTTXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXCGEHLVRTILARECSHALQAEDAHQALLETMQNKFISSPFLA
SEDGVLGGVIVLRSGRCSAEADSSQNKQTLLXXXXXXXXXXXXXXXXXXXXXXXXXTHIS
RLPPGAVAGQSVAIEGGVCRLESPVN
Download sequence
Identical sequences ENSOPRP00000003709 ENSOPRP00000003709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]