SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003764 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003764
Domain Number 1 Region: 543-630
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000000000000795
Family Ricin B-like 0.012
Further Details:      
 
Domain Number 2 Region: 167-230
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.00000000938
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000003764
Domain Number - Region: 399-455
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.000605
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003764   Gene: ENSOPRG00000004083   Transcript: ENSOPRT00000004087
Sequence length 634
Comment pep:novel genescaffold:pika:GeneScaffold_1360:50196:77384:-1 gene:ENSOPRG00000004083 transcript:ENSOPRT00000004087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHLKRLVKLHIKRHYYKKFWKLGSVIFIFVIVLILIQREVSVQYSKEESRIEKSMKKNK
NKMFNLMLEAVNNIKDAMPKMQIGAPVRQNIDVGERPCLQGYYTAAELKPVLDRPLQDSN
APGASGKAFKTTNLSIEEQKEKERGEKKHCFNAFASDRISLHRDLGPDTRPPECIEQKFK
RCPPLPTTSVIIVFHNEAWSTLLRTVHSVLYSSPAVLLKEVILVDDASVDXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVWQCGGQLEIMPCSVVGHVFRS
KCPHSFPKGTQVIARNQVRLAEVWMDEYKEIFYRRNTDAAKIVKQXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXYFEYSAQNEIRHNIQKELCLHATQSLLQLKACTYKGHNTVVTGEQIWEIQKDQLLYN
PHFEMCLSANGEHPNLVQCNPSDLLQKWIFNQNN
Download sequence
Identical sequences ENSOPRP00000003764 ENSOPRP00000003764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]