SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003781 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003781
Domain Number 1 Region: 129-155,184-421
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-68
Family Nuclear receptor ligand-binding domain 0.00000000182
Further Details:      
 
Domain Number 2 Region: 76-161
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.16e-30
Family Nuclear receptor 0.00000936
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003781   Gene: ENSOPRG00000004104   Transcript: ENSOPRT00000004104
Sequence length 423
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2921:89700:99315:1 gene:ENSOPRG00000004104 transcript:ENSOPRT00000004104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSQVAGIEPLYIKAEPASPDSPKGSSETEPEPPVTLAPGPAPTRCHSGHKEEEDGEGAG
PGEQGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNE
CEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFPSPFPAGS
LAVAGGPRKTAAPVNALVSHLLVVEPEKLYAMPDPAGPDGHLPAVATLCDLFDREIVVTI
SWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAA
GLGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQLREALHEALL
EYEAGRAGLGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEA
MMD
Download sequence
Identical sequences ENSOPRP00000003781 ENSOPRP00000003781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]