SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003793 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003793
Domain Number 1 Region: 25-157
Classification Level Classification E-value
Superfamily Hormone receptor domain 4.45e-25
Family Hormone receptor domain 0.00092
Further Details:      
 
Domain Number 2 Region: 140-428
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000265
Family Rhodopsin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003793   Gene: ENSOPRG00000004122   Transcript: ENSOPRT00000004117
Sequence length 521
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5270:32206:90123:1 gene:ENSOPRG00000004122 transcript:ENSOPRT00000004117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLGAPACQGTRPLPSYWAPGSRFLLLALLVSIEQISGSLFEETTRKWVQYREKCLIDLLK
APSGVFCNGTFDQFVCWPHSAPGNVSVLCPSYLPWWSEESSRRAYRRCSAQGTWLKRENG
TGIWQDDSECSEDHKAKQDEDHWNLLFILRQIYTVGYSLSLISLFLALTLFLIFRKLHCT
RNYIHMNLFASFILRAMAVLVRDIVIHRLHSKKPDTEDGWMSYMSEMSASCRSVQVLLHY
FVGAQLWLLVEGLYLHGLLEPTVLSERRLWPRYLLVGWVFPVLFVIPWALARAYLENTSC
WADNENKKIWWIIRGPLLLCVAVNFFIFLKILKLLISKLKAHQMCFRDYKYRLAKSTLVL
IPLLGVHEVIFSFITDDQVERSSKRIRLFFQLSLSSFQGFLVALQYCFFNGEVKAELRRH
WFRFLLARHSGCRACVLGKNFHFLGKCPQKLSEGDGADTLQTLQSSPDNLHPAVRCPGTP
AARPHRGHTPWPRASSLSESSEGDFTLANTMEEILEENRSQ
Download sequence
Identical sequences ENSOPRP00000003793 ENSOPRP00000003793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]