SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003832 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003832
Domain Number 1 Region: 1846-1973
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.82e-18
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 2 Region: 948-1017
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.01e-18
Family TB module/8-cys domain 0.00068
Further Details:      
 
Domain Number 3 Region: 2329-2401
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.05e-18
Family TB module/8-cys domain 0.00052
Further Details:      
 
Domain Number 4 Region: 2050-2119
Classification Level Classification E-value
Superfamily TB module/8-cys domain 9.03e-18
Family TB module/8-cys domain 0.00000899
Further Details:      
 
Domain Number 5 Region: 444-574
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-17
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 6 Region: 1026-1156
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.69e-17
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 7 Region: 1530-1625
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.32e-17
Family TB module/8-cys domain 0.00001
Further Details:      
 
Domain Number 8 Region: 542-658
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.06e-17
Family Growth factor receptor domain 0.0083
Further Details:      
 
Domain Number 9 Region: 2443-2569
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 10 Region: 2129-2246
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.67e-16
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 11 Region: 1684-1750
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.23e-16
Family TB module/8-cys domain 0.00096
Further Details:      
 
Domain Number 12 Region: 1316-1450
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.85e-16
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 13 Region: 724-850
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000151
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 14 Region: 845-929
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000249
Family TB module/8-cys domain 0.002
Further Details:      
 
Domain Number 15 Region: 1195-1311
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000596
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 16 Region: 2569-2685
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000267
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 17 Region: 653-742
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000051
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 18 Region: 1604-1653
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000147
Family EGF-type module 0.00042
Further Details:      
 
Domain Number 19 Region: 249-336
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000863
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 20 Region: 1156-1204
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000216
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 21 Region: 2008-2055
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000455
Family EGF-type module 0.005
Further Details:      
 
Domain Number 22 Region: 1765-1813
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000607
Family EGF-type module 0.0028
Further Details:      
 
Domain Number 23 Region: 1966-2010
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000116
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 24 Region: 1444-1492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000454
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 25 Region: 2282-2330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000524
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 26 Region: 1481-1528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000129
Family EGF-type module 0.00018
Further Details:      
 
Domain Number 27 Region: 1808-1844
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000288
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 28 Region: 2400-2448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000142
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 29 Region: 1646-1689
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000305
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 30 Region: 2256-2293
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000145
Family EGF-type module 0.036
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000003832
Domain Number - Region: 150-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00226
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 327-354
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0353
Family TB module/8-cys domain 0.0063
Further Details:      
 
Domain Number - Region: 116-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0902
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003832   Gene: ENSOPRG00000004041   Transcript: ENSOPRT00000004162
Sequence length 2741
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2374:1075239:1301761:-1 gene:ENSOPRG00000004041 transcript:ENSOPRT00000004162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRGGMLEIVLGFTVILASYTSQGADANLEAGNVKETRASRAKRRGGGGHDALKGPNVCG
SRYNAYCCPGWKTLPGGNQCIVPICRHSCGDGFCSRPNMCTCPSGQISPSCGSRSIQHCN
IRCMNGGSCSDDHCICQKGYIGTHCGQPVCESGCLNGGRCVAPNRCACTYGFTGPQCERX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXVDECQAIPGLCQGGNCINTVGSFECKCPAGHKFNEVSQKCEDIDECSTIPGICD
GGECTNTVSSYFCKCPPGFYTSPDGTRCIDVRPGYCYAALANGRCSNQLPQSMXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXDFNKLCSVPMVIPGRPEYPPPPAGPHLPVPPVPPGFP
PGVTIPGRPPVEYPYPQPSREPPRWLPVNVTDYCQLVRYLCQNGRCIPTPGSYRCECNKG
FQLDLRGECIDVDECEKNPCAGGECINNQGSYTCQCRAGYQSTLTRTECRDIDECLQNGR
ICSNGRCINTDGSFHCVCNAGFHVTRDGRNCEDMDECSIRNMCLNGMCINEDGSFKCICK
PGFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRS
TCYGGYMRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSXXXXXXXXXXXXXXX
XXXXINECALDPDICPNGICENLRGTYKCICNSGYEVDITGKNCVDINECVLNSLLCDNG
QCRNTPGSFVCTCPKGFVYKPDLKTCEDIDECESSPCINGVCKNSPGSFICECSSESTLD
PTKTICIETIKGTCWQTVIDGRCEININGATLKSQCCSSLGAAWGSPCTICQVDPICGKG
YSRIKGTQCEDIDECEVFPGVCKNGLCVNTRGSFKCQCPNGMTLDATGRICLDIRLETCY
LRYDDEECTLPVTGRHRMDACCCSVGAAWGTEECEECPLRNTPEYEELCPRGPGFATKEI
TNGKPFFKDINECKMIPSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRISPD
LCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCINTEGSYRCE
CPPGHQLAPNISACVDINECELSANLCPNGRCVNLMGKYQCACNPGYHSTPDRLFCVDID
ECSIMNGGCETFCTNSEGSYECSCQQGFALMPDQRSCTDIDECEDNPNICDGGQCTNIPG
EYRCLCFDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKSSFICHCDMGSGKKGKTGC
TDINECEIGAHNCGRHAVCTNTAGSFKCSCSPGWIGDGVKCTDLDECSNGTHMCSQHADC
KNTMGSYRCLCKEGYTGDGFSCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSAD
GKACEDIDECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNECLDPTTCISG
NCVNTPGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKA
SCCCSLGKAWGTPCELCPAVNTTEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQGG
KCINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTVGNYTCICPPDYMQ
VNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPS
TDEFANLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYN
DKLLVCEDIDECQNGPVCQRNAECVNTAGSYRCDCKPGYRFTSTGQCNDRNECQEIPNVC
SHGQCIDTVGSFYCLCHTGFKTNADQTMCLDINECERDACGNGTCRNTIGSFNCRCNHGF
ILSHNNDCIDVDECATGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECLLE
PGKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECVEEPEICALGTCSNTEGSFKCLC
PEGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCP
TEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECSFGYILE
GNECVDTDECAVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFR
CVNTYGSYECKCPAGYVLREDRRMCKXXXXXXEGHDCAEKQECKNLIGTYMCICGPGYQR
RPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECNDGFTASPTQDECLDNREGYCFTE
VLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTNGAD
IDECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTACVDLNECNQAPKPCNFICKNT
EGSYQCSCPKGYILQEDGRSCKDLDECSTKQHNCQFLCVNTIGGFTCKCPPGFTQHHTAC
IDNNECTSDVNLCGSKGICQNTPGSFTCECQRGFSLDQTGASCEDVDECEGNHRCQHGCQ
NIIGGYRCSCPQGYLQHYQWNQCVDENECLSAHICGGASCHNTLGSYKCMCPAGFQYEQF
SGGCQDINECGSSQAPCSYGCSNTEGGYLCGCPPGYFRIGQGHCVSGMGMSRGGPEPPVS
GEMDDNSLSPEACYECKINGYPKRGRKRRSANATTDASHIE
Download sequence
Identical sequences ENSOPRP00000003832 ENSOPRP00000003832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]