SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003879 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003879
Domain Number 1 Region: 155-273
Classification Level Classification E-value
Superfamily C-type lectin-like 1.25e-38
Family Link domain 0.0017
Further Details:      
 
Domain Number 2 Region: 997-1144
Classification Level Classification E-value
Superfamily C-type lectin-like 3.67e-29
Family C-type lectin domain 0.0000148
Further Details:      
 
Domain Number 3 Region: 267-368
Classification Level Classification E-value
Superfamily C-type lectin-like 1.46e-19
Family Link domain 0.0067
Further Details:      
 
Domain Number 4 Region: 47-162
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000504
Family V set domains (antibody variable domain-like) 0.039
Further Details:      
 
Domain Number 5 Region: 946-986
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000901
Family EGF-type module 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003879   Gene: ENSOPRG00000004179   Transcript: ENSOPRT00000004208
Sequence length 1248
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4591:14784:28942:1 gene:ENSOPRG00000004179 transcript:ENSOPRT00000004208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTASVWASALVLLPLLLFAAGDEGMEDATHTTTELGLRIHKVGSGAVRAALAELVALPC
VFTLQPRPATTAATAREAPRVKWTKVRTASGQRQDEPILVAKDNVVRVAKGWQGRVSLPA
YPQHRANATLLLGPLRASDSGLYRCQVVRGIEDEQDLVPLEVTGVVFHYRAAQDRYALTF
AQAQEACRLSSATIAAPRHLQAAFEDGFDNCDAGWLSDRTVRYPITQSRPGCYGDRSSLP
GVRSYGRRDPQELYDVYCFARELGGEVFYVGPPRRLTLAGARAQCCRQGNPWASVGQLHL
AWHEGPEQCDPGWLADGSVRYPIQTPRRRCGPAPGVRTVYRFANRTGFPAPGARFDAYCF
RAHHTATPHGDPETPSSGDEGDLLSAEGPPSPELEPSLGEEEDVVTPESQEPLVSSGEEQ
TPLIVMEEQESPDTPRPASAGPTPASWPTKAEEAWLDSVASSSSSLGSVVSTPTGGAPGS
PPPRRRGRFKGLNGRHFQQQQLEPEASAQQPLIPEAAGSHVVPPLVTAATHSPGLVRNQN
PWGELTNELGVTDADFRGGPPRSPARAPDGIPGPSRTPAAMQKEITGASIKPATSDLPWS
LPEASVATPIPRSEDPRTDTWSPDFPVVAMLRAPKLQLTPDPTNAEATTTTPPSLVTGTE
VSAPSPSWDPTGRSGEARPVTAVDTGIGAGSRTPNTTGGPSPWMPVRADLSPAEPTRSGN
VLGPESGVSNVVEISGLQVTVNEVDSTPSAAPSGDPGGLVATRVTPSTVGPGAATEQGTV
VGHTESTVPLESSDAGGTWDSGLLVVVGTQHPTGHPQVTVDASLATPLTPPDLETKADVL
ATCIPASFSSQPQPEPEGRVLAEGATPGVPVAPPPRTPPAASVDEGEPAGPWDAPSTPPP
VSRNTEELEPGILASGPALEGFWEEVASGEEPAPPGTLRNGSAMEAASDPCENNPCLHGG
TCSANGTMYGCSCDRGFAGENCEIDVDDCACSPCENGGTCIDEVNGFVCLCLPSYGGSQC
EKDTERCDRGWHKFQGYCYRYVAQRSWDAEDSRRRADLTSVDPRDQFVNSFGHENTWLGL
NDRTVEGDFQWTDNTGLQYENWREKQPDNFFAGGEDCVVMVAHESGHWNDVPCNYNLPYV
CKKGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXRRSHRMRRHHHRHRHQRHHKSHRKHKGHPAEDWERDEGNLC
Download sequence
Identical sequences ENSOPRP00000003879 ENSOPRP00000003879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]