SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003888 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003888
Domain Number 1 Region: 243-325
Classification Level Classification E-value
Superfamily C-type lectin-like 2.21e-23
Family Link domain 0.0035
Further Details:      
 
Domain Number 2 Region: 7-118
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000792
Family I set domains 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003888   Gene: ENSOPRG00000004236   Transcript: ENSOPRT00000004218
Sequence length 361
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4591:33876:36085:-1 gene:ENSOPRG00000004236 transcript:ENSOPRT00000004218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GESGSVVVQTAPEQVVSHRGGTIVLPCAYHYEAAAHSHDGVRLKWTKVVDPLAFADVFVA
LGPQHRAFGAYRGRAELQNDGPGDASLVLRNVTLQDYGRYECEVTNELEDDAGMVKLDLE
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVFFLKPL
RPVPFVGAARACAARGAAVAKVGQLFAAWKLQLLDRCTAGWLADGSARYPIVNPRARCGG
PKPGVRSLGFPDAQRRLFGVYCYRAPGAPDPAPGGWGWGWAGGGGWAGGARDPASWTPLR
V
Download sequence
Identical sequences ENSOPRP00000003888 ENSOPRP00000003888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]