SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003954 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003954
Domain Number 1 Region: 58-125
Classification Level Classification E-value
Superfamily Hormone receptor domain 2.35e-17
Family Hormone receptor domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003954   Gene: ENSOPRG00000004284   Transcript: ENSOPRT00000004290
Sequence length 439
Comment pep:novel genescaffold:pika:GeneScaffold_493:9238:148068:-1 gene:ENSOPRG00000004284 transcript:ENSOPRT00000004290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLWLSLLLLLLLARAVHTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XCQGLWDNVSCWPSSAPGRTVEVACPRFLQMLSSRNGSLFQNCTPDGWSDTFPRPDLACG
VSVNDSSNERRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLHCTRNYIHMHLFVS
FILRALSNFIKDAVLFSSDDVTYCDAHRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCWDINANASIWWIIRGPVIL
SILXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLARSTLLLIPLFGIHYVVFAFSPED
AMEVQLFFELALGSFQXXXXXXXXXXXXXXVQLEVQKKWQQWHLWEPALRPVALSSSYSN
GTKACPAEHSRDTHKASII
Download sequence
Identical sequences ENSOPRP00000003954 ENSOPRP00000003954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]