SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004001 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004001
Domain Number 1 Region: 386-480
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.75e-30
Family Transglutaminase core 0.00000303
Further Details:      
 
Domain Number 2 Region: 624-717
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.62e-24
Family Transglutaminase, two C-terminal domains 0.00000841
Further Details:      
 
Domain Number 3 Region: 177-259
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.03e-20
Family Transglutaminase core 0.0000142
Further Details:      
 
Domain Number 4 Region: 95-175
Classification Level Classification E-value
Superfamily E set domains 6.3e-18
Family Transglutaminase N-terminal domain 0.0000175
Further Details:      
 
Domain Number 5 Region: 318-355
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0000000027
Family Transglutaminase core 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004001   Gene: ENSOPRG00000004344   Transcript: ENSOPRT00000004342
Sequence length 718
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2057:369078:394592:-1 gene:ENSOPRG00000004344 transcript:ENSOPRT00000004342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISAPRSLRTASGSHLEGSLTCLRSCGHRCPTMAEXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPAPSEEAGTKARFPLSDAVEEGAWT
ATVVDQQDCVLSLQFSTPASAPIGLYRLSLEASTGYQGSSFVLAHFTLLFNAWCPADAVY
LDSEEERREYVLTQQGFIYQGSAKFINRIPWNFGQFEDEILDICLTLLDVNPKFLKNSSR
DCSRRSSPVYVGRVVSVMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXLRCLGVPTRVVTNFNSAHDQNSNLLIEYFHDKDGVLQRDKSE
MIXXXXXXXXXXXXXXXXXXXXXXXQALDPTPQEKSEGTYCCGPVPVRAIKEGDLSTKYD
APFVFAEVNADVVDWIQHEDGSVHKSINRSQVVGLNISTKSVGRDERQDITHNYKYPEXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXVLGEPKQNRKLVAEVSMQNPLSVPLIGCCFTVEGAGL
TKEQLRVEISDPVEAGEVVKVRVDLLPLHVGLNKLVVNFESDKLKSVKGFRNIIIGPP
Download sequence
Identical sequences ENSOPRP00000004001 ENSOPRP00000004001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]