SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004022 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004022
Domain Number 1 Region: 485-678
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.41e-67
Family PDEase 0.000017
Further Details:      
 
Domain Number 2 Region: 238-283,310-460
Classification Level Classification E-value
Superfamily GAF domain-like 1.09e-30
Family GAF domain 0.00085
Further Details:      
 
Domain Number 3 Region: 56-160
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000000214
Family GAF domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004022   Gene: ENSOPRG00000004348   Transcript: ENSOPRT00000004363
Sequence length 678
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2393:93547:135687:1 gene:ENSOPRG00000004348 transcript:ENSOPRT00000004363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDLSQDAVEKYLEQNPQFAKEYFDKRLRAEALGEIFKNNQAPVQTSMSFAELTQVEEAA
VCLELLLSVQEEASSAELAAHRALQRLAQLLQAERCSLFICRARNGTSEVASRLLDVTAT
SKFEDNLVVPEREVVFPLDIGIVGWVAHTKKTLNVPDVKKXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVFSKYINFVSVILKLHHTNYLYNIESRRS
QILMWSANKVFEELTDVERQFHKALYTVRTYLNCERYSIGLLDMTKEKEFYDEWPIKLGE
VEPYKGPKTPDGREVIFYKIIDYILHGKEEIKVIPSPPADHWTLVSGLPTYVAENGFICN
MLNAPADEYFTFQKGAVDETGWVIKNVLSLPIVNKKEDIVGVATFYNRKDGKPFDEHDEH
ITETLTQFLGWSLLNTDTYEKMNKLENRKDIAQEMLMNHTKATPEEIESILKFREKLNKD
AIEDCEEKQLLTILKEDLPDPKAVELYEFRFSDFPITEHGLIKCGLRLFFEINVVEKFKV
PVEVLTRWMYTVRKGYRAVTYHNWRHGFNVGQTMFTLLMTGRLKKYFTDLEAFAMLAAAF
CHDIDHRGTNNLYQMKSTSPLAKLHGSSILERHHLEYSKTLLQDESLNIFQNLNKRQFET
VIHLFEVAIIATDLALYF
Download sequence
Identical sequences ENSOPRP00000004022 ENSOPRP00000004022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]