SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004144 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004144
Domain Number 1 Region: 27-127
Classification Level Classification E-value
Superfamily Hormone receptor domain 6.02e-26
Family Hormone receptor domain 0.00034
Further Details:      
 
Domain Number 2 Region: 161-408
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000192
Family Rhodopsin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004144   Gene: ENSOPRG00000004496   Transcript: ENSOPRT00000004503
Sequence length 456
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4514:294668:324060:1 gene:ENSOPRG00000004496 transcript:ENSOPRT00000004503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPQSPPPTRWLCVLAGALACALGPTGGRATRMHQECDYLQMIEMQRRQCLEEAQLENET
AGCSKMWDNLTCWPATPRGQVVVLACPLIFKLFSPIQGRNVSRSCTDEGWTHLEPGPYPV
ACGLNDKASSLDEHHRIGYNSLKTGPIRYSPDLAALLVATAILNRFQKLHCTRNYIHMHL
FISFILRAAAVFIKDLALFDSGESDQCSEGSVGCKVAVVFFQYCVMANFFWLLVEGLYLH
TLLAVSFFSERKYFWGYILIGWGVPSTFTMVWTVIRIHFEDYGCWDTINSPLWWIIKGPI
LASILVNFVLFICIIRILVQKLRPPDIGKSDSSPYSRLAKSTLLLIPLFGVHYIMFAFFP
DNFKAEVKLVFELVVGSFQGFVVAVLYCFLNGEVQAELRRKWRRWHLQGVLGWHPKYQQP
SVGSNGATSSTQVSMLTRVSPSARRASSFQAEVSLV
Download sequence
Identical sequences ENSOPRP00000004144 ENSOPRP00000004144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]