SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004331 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004331
Domain Number 1 Region: 116-353
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.5e-68
Family Pancreatic carboxypeptidases 0.00000075
Further Details:      
 
Domain Number 2 Region: 16-108
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 6.8e-26
Family Pancreatic carboxypeptidase, activation domain 0.0000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004331   Gene: ENSOPRG00000004712   Transcript: ENSOPRT00000004704
Sequence length 355
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2723:163097:190449:1 gene:ENSOPRG00000004712 transcript:ENSOPRT00000004704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAILVLAAAALANAHHSHEHFDGEKVLRVNVEDETHINLIQELASVNQIDFWKPDSASQ
ISPHSAVDFRVKAEDIDSVENFLNQNELQYEVLIDNLKHVLEEQFDSQVRATGHSYVKYN
NWDTIEAWTKEVAAQNPNLISRSVLGTTFEGRSIYVLKXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXAINNYGKDTVTTELLDKLDFYVVPVVNIDGYIYTWTKNRMWRKTRSTK
SGTSCVGVDPNRNFDAGWCQLGASSSACDETYCGSAPESEKETKALADFIRNNLSSIKAY
LTIHSYSQLLLYPYSYSYKLPSNNAELNALAKAAVQKLKALYGTKYTYGPGATTI
Download sequence
Identical sequences ENSOPRP00000004331 ENSOPRP00000004331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]