SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004374 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004374
Domain Number 1 Region: 16-145
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.35e-29
Family G proteins 0.00000372
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004374   Gene: ENSOPRG00000004762   Transcript: ENSOPRT00000004752
Sequence length 154
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2667:3:5946:-1 gene:ENSOPRG00000004762 transcript:ENSOPRT00000004752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIAXXXXXXXXXXXXXXXXXXX
XXXXXXXXLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQL
QGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQD
Download sequence
Identical sequences ENSOPRP00000004374 ENSOPRP00000004374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]