SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004385 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004385
Domain Number 1 Region: 505-617
Classification Level Classification E-value
Superfamily TPR-like 3.47e-20
Family Tetratricopeptide repeat (TPR) 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000004385
Domain Number - Region: 417-450
Classification Level Classification E-value
Superfamily TPR-like 0.0187
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 
Domain Number - Region: 116-180
Classification Level Classification E-value
Superfamily SIS domain 0.0215
Family mono-SIS domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004385   Gene: ENSOPRG00000004754   Transcript: ENSOPRT00000004763
Sequence length 630
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3700:218934:257778:1 gene:ENSOPRG00000004754 transcript:ENSOPRT00000004763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERSHKSYRPLTVLTFRLNYLFSELKPMSYHLLNMIFHAIVSVIFLKVCKLFLDNRSSVIA
ALLFTVHPIHTEAVTGVVGRAELLSSIFFLAAFLSYTKSKGPDNSIVWTPIALTVFLVAV
ATLCKEQGITVVGICCVYEVFIAQGYTLPLLCTTAGQFLRGKSSIPLSMLQTLIKLIVLM
FSTLLLVVIRVQVIQSQLPVFTXXXNPSAVSSTYLRQLTFNYLLPVTAWPLLNPSYLCCD
WTMGTIPLIESFLDVRNLATFAFFCLLGTLGVFSLRYPGDSSKTVLMXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDIGAH
MNVGRTYKNLNRTKEAEESYMTAKSLMPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXGELLLKMNKPLKAKEAYLKALELDRNNADLWYNL
AIVYIELKEPNEALKNFNHALELNPKHKLALFNSAILMQESGEVKLRPEARKRLLSYITE
EPQDANGYFNLGILCTAQECNTLCRRTAGK
Download sequence
Identical sequences ENSOPRP00000004385 ENSOPRP00000004385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]