SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004465 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004465
Domain Number 1 Region: 261-375
Classification Level Classification E-value
Superfamily C-type lectin-like 7.42e-32
Family C-type lectin domain 0.00000578
Further Details:      
 
Domain Number 2 Region: 224-258
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.00000000222
Family Triple coiled coil domain of C-type lectins 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004465   Gene: ENSOPRG00000004861   Transcript: ENSOPRT00000004847
Sequence length 375
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4843:98649:104587:-1 gene:ENSOPRG00000004861 transcript:ENSOPRT00000004847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLVLLFTLFLLTQPHGHLGAEVKTYSRAAVSNACTLVMCSSVENGLPGRDGRDGREGPR
GEKGDPGVPGATGLAGLPGPTGPVGPKGDNGSAGEPGPKGDTGPCGPPGLPGVPGPVGRE
GASGKQGNIGPQGKPGPKGETGPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITTLRQQMEALQGQLQH
LQTALSQYRKVILFADAQRVGEKIFKVAGFEKHYEEAQQVCAQAGGQLPSPRNAAENHAL
QELLTMKNKAAFLSMTDTKTEGTFTYPTGEPLVYSNWAPGEPNNNGGSENCVEIFSNGKW
NDKVCGEQRLVVCEF
Download sequence
Identical sequences ENSOPRP00000004465 ENSOPRP00000004465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]