SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004497 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004497
Domain Number 1 Region: 28-153
Classification Level Classification E-value
Superfamily Hormone receptor domain 8.89e-28
Family Hormone receptor domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000004497
Domain Number - Region: 354-437
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000156
Family Rhodopsin-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004497   Gene: ENSOPRG00000004881   Transcript: ENSOPRT00000004880
Sequence length 551
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2696:18513:100911:1 gene:ENSOPRG00000004881 transcript:ENSOPRT00000004880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWPGASRXXXXXXXXXXXXXXXXXXLDSSGTVTIEEQIVLMMKAKVQCERNITAQLQEG
EGNCFPEWDGLICWPRGTVGKILAVPCPSYIFDFNHKGVAFRHCNPNGTWDFVHSLNKTW
SNYSDCLRFMQSDISIGKEEFFERLYVVYTVGYSISLGSLVVAVLLIGYFXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFPAVFVAAWAVERA
ILADAXXXXXXXXXXXXXXXXXXXXXXXLNFILFLNTVRILATKFWETNALGHDMRRQYR
KLAKSTLVLVLVFGVHYIVFICLPHSFTGLGWEIRMHCELFFNSFQGFFVSIIYCYCNGE
VQAEVKKLWSRWNPSLDWKRMPPCGSHRYGSVLTTVTHSSSSQSQMAASTHMVLLAGRAS
KPIPRQPDSHVTLPGYVRSNSEQECLPHTVQKETEEGNERQGFGAPVAESFRALEVNPDA
EGCKAVTEDAV
Download sequence
Identical sequences ENSOPRP00000004497 ENSOPRP00000004497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]