SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004597 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004597
Domain Number 1 Region: 220-482
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.57e-74
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000232
Further Details:      
 
Domain Number 2 Region: 9-77
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000334
Family Biotin repressor-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004597   Gene: ENSOPRG00000005004   Transcript: ENSOPRT00000004999
Sequence length 508
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3816:82142:93673:-1 gene:ENSOPRG00000005004 transcript:ENSOPRT00000004999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGPVAELLLRRLETADGGLDSADLATQLGVEHQAVVGAVKSLQALGEVIEAELRSTKR
WELTAEGEEIAREGSHESRVLRSIPSEGLVQSELMRLPSGKVGFSKAMSNKWIRVDKSAA
DGPRVFRVVDTVEDEVQRRLRLVQSGQAEKLGEKERSELRKRKLLTEVTLKTYWVSKGSA
FSTSISKQETELSPEMISSGSWRDLSFKPYNFSARGILPDSGHLHPLLKVRSQFRQIFLE
MGFTEMPTDNFIESSFWNFDALFQPQQHPARDQHDTFFLRDPAQTLQLPTDYVQRVKRTH
SQGGYGSQGYKYNWKLEEARKNLLRTHTTAASARALYRLAQKKPFTPVKYFSIDRVFRNE
TLDATHLAEFHQIEGVVADHGLHLGHLMGILREFFTKLGITQLRFKPAYNPYTEPSMEVF
SYHQGLKKWVEVGNSGIFRPEMLLPMGLPENVSVIAWGLSLERPTMIKYGINNIRELVGH
KVNLQMVYDSPLCRLEAKSAPPRTQEAT
Download sequence
Identical sequences ENSOPRP00000004597 ENSOPRP00000004597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]