SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004608 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004608
Domain Number 1 Region: 519-597
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.29e-18
Family Cold shock DNA-binding domain-like 0.0025
Further Details:      
 
Domain Number 2 Region: 63-138
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.57e-17
Family Cold shock DNA-binding domain-like 0.0000157
Further Details:      
 
Domain Number 3 Region: 351-432
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000101
Family Cold shock DNA-binding domain-like 0.0018
Further Details:      
 
Domain Number 4 Region: 676-756
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000024
Family Cold shock DNA-binding domain-like 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000004608
Domain Number - Region: 492-527
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0857
Family Cold shock DNA-binding domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004608   Gene: ENSOPRG00000005002   Transcript: ENSOPRT00000005010
Sequence length 798
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1422:206956:241870:-1 gene:ENSOPRG00000005002 transcript:ENSOPRT00000005010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENVFTVSSDPHPPSAAPSSLSLPLSSSSTSSGTKKQKKTPTYQRSMSFDPNLLHNNGHN
GYPNGTSAALRETGVIEKLLTSYGFIQCSERQARLFFHCSQYNGNLQDLKVGDDVEFEVS
SDRRTGKPIAVKLVKIKSEILPEERMNGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXTGAVSARNIMLLKKKQAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDPLPG
RIKVDFVIPKELPFGDKDTKSKVTLLEGDHVRFNISTDRRDKLERATNIEVLSNTFQFTN
EAREMGVIAAMRDGFGFIKCVDRDARMFFHFSEILDGNQLHIADEVEFTVVPDMLSAQRN
HAIRIKRLPKGTVSFHSHSDHRFXXXXXXXXXXXXXXXXXXXXXXXXEAEDGIIAYDDCG
VKLTIAFQAKDVEGSTSPQIGDKVEFSISDKQRPGQQIATCVRLLGRNSNSKRLLGYVAT
LKDNFGFIETANHDKEIFFHYSEFSGDVDSLELGDMVEYSLSKGKGNKISAEKVNKTHSV
NGITEEADPTIYSGKVIRPLRSVDPTQTEYQGMIEIVEEGDMKGEVYPFGIVGMANKGDC
LQKGESVKFQLCVLGQNAQTMAYNITPLRRATVECVKDQFGFINYEVGDSKKLFFHVKEV
QDGIELQAGDEVEFSVILNQRTGKCSACNVWRVCEGPKAVAAPRPDRLVNRLKNTTLDDA
SAPRLMVLRQPRGPDNSM
Download sequence
Identical sequences ENSOPRP00000004608 ENSOPRP00000004608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]