SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004663 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004663
Domain Number 1 Region: 264-321
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0000000314
Family Hormone receptor domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004663   Gene: ENSOPRG00000005042   Transcript: ENSOPRT00000005067
Sequence length 834
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3355:41919:57579:1 gene:ENSOPRG00000005042 transcript:ENSOPRT00000005067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGIHCIPAAVPSSIPSPAPKAATLAGQHERCHRATPPTPPSPRHRQPVQEGLGGRGREGY
LSAVEGQDQELVQPAQACGTDRGQQGAHVDVCQKTHEFMHVRECGRPTPPVCTPDAHGRT
QEAGHTQRHTAVRRRRDGAGCGGRAPLSETSRTPGWPSQLETPWPCEPLLLLPPRDAVDA
DDVFTKEEQIFLLHRAQAQCDKLLKEVQRRPLAASTPCSISAADIMESDKKWTSVSTSGK
PRKEKLSGKLYVESKEDTELPAGSRHRGHAYRRCDRNGSWELVPGHNRTWANYTECLKFM
SNETREREVFDRLGLIYTVGYSMSLASLTVAVLILAYFRWAWGVGLKCGNATVPSSLSPT
PSWRLPSYRRLHCTRNYIHMHLFLSFMLRAVSIFVKDAVLYSGFTLDEAERLTQEELRLI
AQAPPPPAAAAAAGYVSATPARFLPCQWHAARPSPCLSPVRVTVLGTPELRTQPGFCMSH
VAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTVFGWGLPAIFVAVWVSV
RATLANTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSGLAMTS
LPRPRKLLKSTLVLMPLFGVHYTVFMAMPYTEVSGTLWQIQMHYEMLFNSFQVCGPRRPG
RGQGRSGQGGRPDPGPLSPQGFFVAIIYCFCNGEVQAEIKKSWSRWTLALDFKRKARSGS
SSYSYGPMVSHTSVTNVGPRAGLGLSLSPRLLPAATANGHPQLPGHAKPGVPALEATQPA
MAVPKDDGFLNGSCSGLDEEPSGPERPPALLQEEWETVIFRDCLRGSPEGRGLV
Download sequence
Identical sequences ENSOPRP00000004663 ENSOPRP00000004663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]