SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004757 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004757
Domain Number 1 Region: 192-502
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.64e-116
Family Transglutaminase core 0.0000000000241
Further Details:      
 
Domain Number 2 Region: 9-191
Classification Level Classification E-value
Superfamily E set domains 1.29e-56
Family Transglutaminase N-terminal domain 0.0000000176
Further Details:      
 
Domain Number 3 Region: 517-628
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 9.68e-32
Family Transglutaminase, two C-terminal domains 0.00000412
Further Details:      
 
Domain Number 4 Region: 630-727
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.63e-27
Family Transglutaminase, two C-terminal domains 0.00000548
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004757   Gene: ENSOPRG00000005170   Transcript: ENSOPRT00000005177
Sequence length 732
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1740:73754:215132:-1 gene:ENSOPRG00000005170 transcript:ENSOPRT00000005177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSETSSSTFGGRSAVPPNNSNAAEDELPTVELQGLVPRGVNLQDYLSVTDVHLFKERWDT
NKLDHHTDKYDNTKLIVRRGQPFYVQIDFNRPYDPTRDFFRVEYVIGRYPQENKGTYIPV
PVVSELQSGKWGAKVIMREDRSVRLSIQSSPDCIVGKFRMYVAVWTPYGILRTLRNPETD
TYILFNPWCEEDAVYLEDEKEKEEYVLNDIGVIFYGDVSDIKSRSWSYGQFEEGILDACL
YVMDRAQMDLSGRGNPIKVSRVGSAMINAKDDDGVIVGSWDNIYAYGVPPSAWTGSVDIL
LEYRSSENPVRYGQCWVFAGVFNTFLRCLGIPARVITNYFSAHDNNANLQMDIFLEEDGT
VSSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAIKH
GHVCFQFDAPFVFAEVNSDLIYITAKKDGTHVVEAVDTRHVGKLIVTKQIGADGISDITD
TYKFQEGREEERLALETALMYGAKKALSTDSAIKSKSDVDMNFKVENAVLGKDFKLTVTF
QNNSPNRYTISAYVSGNIVFYTGVSKAVFKNETFSVVLEPRSFKSEEVLVRASEYMGQLL
EQASLHFFVTARVNETKDVLADQRSVMLRIPKVVIKVRGTPEVGSDMVFTVEFTNPLKET
LQNVWLYVEGPGVMRPKRKLFREVRPNATVQWEEVFRPWVSGPRKLIASMTSDSLRHVYG
ELDLQIRRQSSM
Download sequence
Identical sequences ENSOPRP00000004757 ENSOPRP00000004757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]