SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004781 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004781
Domain Number 1 Region: 5-222
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.28e-58
Family D-ribulose-5-phosphate 3-epimerase 0.0000039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004781   Gene: ENSOPRG00000005213   Transcript: ENSOPRT00000005203
Sequence length 231
Comment pep:novel genescaffold:pika:GeneScaffold_3000:226051:242419:1 gene:ENSOPRG00000005213 transcript:ENSOPRT00000005203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGXXXXXXXXXXXXXESLRKQ
LGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVMMVGL
AIKPGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGG
VGPDTIHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDR
Download sequence
Identical sequences ENSOPRP00000004781 ENSOPRP00000004781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]