SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004899 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004899
Domain Number 1 Region: 392-653
Classification Level Classification E-value
Superfamily YWTD domain 5.62e-44
Family YWTD domain 0.00000838
Further Details:      
 
Domain Number 2 Region: 1433-1693
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-43
Family YWTD domain 0.00000925
Further Details:      
 
Domain Number 3 Region: 706-960
Classification Level Classification E-value
Superfamily YWTD domain 9.94e-41
Family YWTD domain 0.0000207
Further Details:      
 
Domain Number 4 Region: 2384-2615
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-36
Family YWTD domain 0.0000111
Further Details:      
 
Domain Number 5 Region: 2090-2330
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-33
Family YWTD domain 0.0000249
Further Details:      
 
Domain Number 6 Region: 4049-4319
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-20
Family YWTD domain 0.00041
Further Details:      
 
Domain Number 7 Region: 3361-3456
Classification Level Classification E-value
Superfamily YWTD domain 6.28e-16
Family YWTD domain 0.00051
Further Details:      
 
Domain Number 8 Region: 288-381,651-702
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000298
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 9 Region: 1333-1423,1694-1737
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000282
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 10 Region: 1260-1301
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000484
Family LDL receptor-like module 0.00056
Further Details:      
 
Domain Number 11 Region: 1060-1099
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000131
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 12 Region: 2729-2770
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000406
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 13 Region: 26-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000694
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 14 Region: 2980-3022
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000785
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 15 Region: 2851-2890
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 16 Region: 3620-3659
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 17 Region: 2897-2933
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.00047
Further Details:      
 
Domain Number 18 Region: 215-255
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000034
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 19 Region: 1101-1139
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 20 Region: 3918-3956
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 21 Region: 3713-3747
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000654
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 22 Region: 66-102
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000969
Family LDL receptor-like module 0.00061
Further Details:      
 
Domain Number 23 Region: 1018-1056
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 24 Region: 3833-3869
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 25 Region: 3790-3827
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 26 Region: 3747-3786
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 27 Region: 181-217
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 28 Region: 3578-3622
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 29 Region: 106-144
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 30 Region: 2692-2730
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000838
Family LDL receptor-like module 0.00062
Further Details:      
 
Domain Number 31 Region: 1224-1259
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000109
Family LDL receptor-like module 0.00065
Further Details:      
 
Domain Number 32 Region: 1143-1177
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000011
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 33 Region: 3540-3581
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 34 Region: 3503-3538
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 35 Region: 3875-3913
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000393
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 36 Region: 1180-1218
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 37 Region: 146-179
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 38 Region: 2937-2981
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000393
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 39 Region: 3023-3061
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000785
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 40 Region: 1305-1341
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000106
Family LDL receptor-like module 0.0035
Further Details:      
 
Domain Number 41 Region: 260-292
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000122
Family LDL receptor-like module 0.0034
Further Details:      
 
Domain Number 42 Region: 2775-2811
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000013
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 43 Region: 4000-4032
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000144
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 44 Region: 2821-2860
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000537
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 45 Region: 4374-4405
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000558
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000004899
Domain Number - Region: 3962-4000
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000153
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 3061-3091
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000157
Family LDL receptor-like module 0.0037
Further Details:      
 
Domain Number - Region: 2336-2380
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000314
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 975-1018
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0015
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 3460-3492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0111
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 4320-4404
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0345
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004899   Gene: ENSOPRG00000005238   Transcript: ENSOPRT00000005336
Sequence length 4649
Comment pep:novel genescaffold:pika:GeneScaffold_407:85343:286995:-1 gene:ENSOPRG00000005238 transcript:ENSOPRT00000005336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELRTAAAACVLFLALSAWSVPVSGQDCSSGHFRCGSGNCIPQAWRCDGTNDCEDDSDEA
GCPHASCHPGFFQCQSDGLCVPQSWVCDGDEDCQDNSDEQHCSGSTCSSHQLTCSSGQCI
PREYRCDHISDCSDGTDEKDCQYPICDQLTCASGACYNTSQKCDGKIDCRDSSDEFNCTS
VCAHNEFQCGDGNCIPRSYVCDHDFDCDDNSDERSCIYQTCGGNQFTCSNGRCIHQHWVC
DGQADCDDQGDEEGCDGSHPKCYPRQWACPRSGKCIPISKVCDGILDCPGGEYKNSTTAG
RSCSMTMCPTLNCEFQCHQTPYGGSCFCPPATIINHNDNRTCVGFNDCQIWGICDQKCEY
QLGHHRCQCEDGYILEREQHCKANASFVEASVIFSNGRDLLIGDIHGRSFQILVQSQHRG
MAVGVDFHYHLHRVFWTDTVQDKVFSVDITGLNVQEVLDVSVEAAENLAVDWINDKLYLV
ETKVSRIDVVNLDGSQRLTLITEDLGRPRGIAVDPVVGYLFFSDWASLSGEPKLERAFMD
GSNRKDLVKTKLGWPAGITLDLVSKRVYWVDCRFDYIETVTYDGIQRKTVIRGGSRVPHP
FGISLFEGHVFFTDWTKMAVMKANKFTETNPQVFYQSSLRTHGVTVYHALRQPNATNPCR
GNNGGCEQVCLLSHRTDNGGLGYRCKCLFGFQLDTDERHCVAVKSFLIFSLGSAVRGIPF
FRSAQEDVMVPLTNSLSFFVGIDFDAQERAIFYSDTSRNMIYKQKIDGTGREIITANRVE
NVESLAFDWISRNLYWIDPSYRSVSVMKLADKSRRTIVEHLNNPRAIVVHPVAGYIFFSD
WFRPAKILRAWGDGSHLVPIVNTTIGWPNGLAIDWGTSRLYWVDAFFDTIEHSTFDDLDR
RKLSHIPQMTHPFGITVFQNYVFVTDWALKGIIQVRKTDGRDMTIVRSGINNIMHVKSYD
VSIQIGSNFCNQSTHPNGDCSHFCFPVPNFQRVCGCPYGMRLASNHLTCEGDPVNEPPTQ
QCGAFSFSCDNGKCIPSYYRCDGFNDCHDNSDEHLCGTSNITCSPSAFTCGDGECIPAHW
RCDRRNDCLDGSDEHNCSTQTPTSCPAYSYTCDNNACIPRNWVCDTDNDCGDGSDEKNCQ
STGTCRPTQFHCPDHRCLDPSFVCDGDKDCVDGSDEACVFNCTSSQFKCADGNGCISNIN
RCDGVFHCNDHSDEAGCPTRPAGMCHSDEFQCQADGYCIPDVWECDGHSDCADGSDEHHG
CVPKTCTVSEFRCHNGNCIPQSWLCDGDNDCRDMSDEKDCPTQPFHCLSWQWQCPGYNIC
VNLSALCDNVFDCPNGTDESPLCSQASCSDFNGGCTHQCIQGPFGATCLCPVGYQLANDS
KTCEDINECDIPGFCSQHCFNMRGSFRCSCDKEYVLESDGRTCKAIASENLLLLVASQSQ
IVADNITSGIHNIYSLVHDGSNIVAVDFDSVSGRIFWSDANQGKTCSAFQNGTDRRVVID
SGVAMTQSVAVDWIGCNLYWTDYALETIEVSRIDGSHRTVLISKNVSNPRGLALDPRMSD
HLMFWSDWGHHPRIERASMDGSMRTIIVQNKIALPCGLTIDYPNRLLYFMDSYLDYIDVC
DYYGHHRRQVVASDLVLRYPYALSLFEDTMYWTDTTTHQVMKANKWHGANQSVVMFNVHQ
PLGIVVVHPSKQPESVNPCASAHCSHLCLLSSQGPNFYSCVCPSGWNLSHDSVNCVRXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLTLRGEARYRKMLITNDG
TALGVGFPIGITVDPVRGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRNALHVDVDVA
SGFIYWCDFSSSVRSYNAIHRIKPDGSSFTSLITNGIGANGVRSIAVDWVAGNLYFTNAF
VSETLIEVLRINTTYRRILLKVTVDMPRHIVVDPKNRYLFWADYGQKPKIERSLLDCTNR
TVLVSDGIVTPRGLAVDRSNGYIYWVDDSLDIIARIHPNGGESEVVRYGSRYPTPYGITV
FQDSIIWVDRNLKKIFQASKEPANTQSPTVIRDNINWLRDVTIFDEHVQPRSPSEVNNNP
CLENNGGCSHLCFALPGLSTAKCGCAFGTLQSDGKSCAISTENFLIFAMGNSLRSLHLDP
ENHSPPFQEIDVQRTAIAVDYDNINNRFYFTQQVTSGRGQISYISLYSGSQSPTVIASDI
GTPDGIAFDWINKRIYYSDYSNQTINSMAEDGSNRTIIARVPKPRAIVLDPCRGYMYWTD
WSTNAKIERATLGGNFRIPIVNTSLVWPNGLTLDYETDLLYWADASLQKIERSSLTGTER
EVIINTAFHAFGLTIYDQYIYTDFYTQRIYRANKYXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXPNGAECQCPHEGQWYLANNGKHCIVDSGTRCAEFQFT
CLNGRCIQEQWKCDNDNDCGDNSDELQNVCAFHTCPPTAFTCANGRCVHYHYRCDYYNDC
GDNSDEAGCLFRRCNDTTEFTCSNGRCIPQSFVCDGRNNCHDNDTSDEKHCXXXXXXXXX
XXCQNTNICIPRLYLCDGDNDCGDLSDENPTYCTTHTCASNEFQCSSGRCSPQHWHCDQE
VDCPDGSDEPASCAQHPRTCSSNEYRCDSGRCIPKEWICDGDNDCGDMSDEDQRHHCETH
NCSSSEFLCVNNRPPARRCISRAWICDGDADCVDAADEHQNCTRRSCSANEFTCWNGLCI
PQSFRCDRRNDCGDYSDERDCTYATCHVSEFTCQNGRCINKAFVCDGQNDCDQTDETEHL
CHIPETCPPHQFKCDNGHCIEMVKVCNHLDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XAITIDYTNDHLYWADAHLGYIEYSDLEGRRRHTVYDGTLPHPFAITIFEDTIYWTDWNT
RTVEKGNKYDGSGRVVLVNTTHRPFDIHVYHPYRQPIVNNPCGINNGGCSHLCLIKEGGN
GFTCECPDDFQTVRMGGSTHCLPMCSSTQFLCANNEKCIPIXXXCDGQRDCSDGSDESFL
CPQRYCRLGRFQCKDGNCTSPHALCNAHQDCPDGSDEDHALCDNHRCESNEWQCANKRCI
PEAWQCDTVDDCGDNSDEDSSHCASRTCHPGQFKCDNGRCIPSSWKCDVDNDCGDHSDEP
LHECXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDITCDPLGDFRC
RNHHCIPLRWRCDGHNDCGDNSDEESCAPRECTESEFRCASQQCIPSQWICDQDNDCGDN
SDERDCDVRTCHPDYFQCTSGHCVLNHLKCDGRADCLDASDEATCPTRFPNGTYCPATMF
ECKNHVCIQSFWKCDGDNDCGDGSDEELHLCLGVPCDPPNRFRCDNSRCIYSHQRCNGID
DCGDGTDEKEENCRPPTPRPCTQDEFKCSNERCISQHYVCDDVDDCGDRSDEMGCNLGQN
RTCAENLCEHNCTELSGGGFICSCKPGYRAGVLDRNFCLDINECEQFGVCPQKCQNTKGS
YECFCADGFKSMSVRYGERCAADGDPPLLLLPENVRIRKYNVSSEKFSDYLEDEERIQAV
DYDWDPEGIGLSVVYYTVLAQGSEFGAIKRAYIPNFESGSNNLIHEEDLGLKYIMQPDGL
AVDWVGRHIYWSDAKNQRIEVARLDGRYRKWLITTQLDQPATIVVNPKLGXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXTGLSIDYLNNDQIYWSDMKEDIIETIKYDGSDRRII
SQGVVKPYSLDIFEDQLYWVAKENGEVWKQDKFGKGEKEKMLVVNPWLTQVRVFHQLRYN
KSVLNPCKQVCSHLCLLRPGGYSCACPQGSNFLEGSTTECDAAIELPITMPPPCRCMYGG
TCYFDENDLPKCKCASGYTGQYCEIGFSKGVPPGTTAMAVLLTILLIAIVGALATVAFFH
YRKTGSLLPSLPKLPSLSSLVKPSENGNGVTFRSGVDDNMEIGVSGFGPESVIDTAMSLS
DHFALELGKQPVIFENPMYATRDSAMKAALPPEVVVTGNVDNKNYGVAMDPLEPVPETAA
VSPGADGFQIPKWNIFKRKPKQTTNFENPIYAEMDNGQKEGDAVAPPPSPSFPEKISPKR
GATAAYSATEDTFKDTANLVKAVKDDSEV
Download sequence
Identical sequences ENSOPRP00000004899 ENSOPRP00000004899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]