SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004969 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004969
Domain Number 1 Region: 3001-3106
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 3.91e-28
Family Lipoxigenase N-terminal domain 0.047
Further Details:      
 
Domain Number 2 Region: 295-429
Classification Level Classification E-value
Superfamily C-type lectin-like 4.9e-23
Family C-type lectin domain 0.0023
Further Details:      
 
Domain Number 3 Region: 1572-1691
Classification Level Classification E-value
Superfamily PKD domain 1.02e-20
Family PKD domain 0.006
Further Details:      
 
Domain Number 4 Region: 976-1098
Classification Level Classification E-value
Superfamily PKD domain 1.5e-20
Family PKD domain 0.0029
Further Details:      
 
Domain Number 5 Region: 1911-2034
Classification Level Classification E-value
Superfamily PKD domain 6.12e-20
Family PKD domain 0.0024
Further Details:      
 
Domain Number 6 Region: 1317-1432
Classification Level Classification E-value
Superfamily PKD domain 1.05e-19
Family PKD domain 0.0049
Further Details:      
 
Domain Number 7 Region: 161-251
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000392
Family PKD domain 0.0000401
Further Details:      
 
Domain Number 8 Region: 1439-1519
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000942
Family PKD domain 0.0085
Further Details:      
 
Domain Number 9 Region: 1197-1264
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000116
Family PKD domain 0.0049
Further Details:      
 
Domain Number 10 Region: 1109-1179
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000471
Family PKD domain 0.0046
Further Details:      
 
Domain Number 11 Region: 1702-1773
Classification Level Classification E-value
Superfamily PKD domain 0.000000458
Family PKD domain 0.0083
Further Details:      
 
Domain Number 12 Region: 11-73
Classification Level Classification E-value
Superfamily L domain-like 0.000000462
Family Ngr ectodomain-like 0.0035
Further Details:      
 
Domain Number 13 Region: 790-902
Classification Level Classification E-value
Superfamily PKD domain 0.00000103
Family PKD domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000004969
Domain Number - Region: 1776-1858
Classification Level Classification E-value
Superfamily PKD domain 0.000275
Family PKD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004969   Gene: ENSOPRG00000005348   Transcript: ENSOPRT00000005411
Sequence length 3718
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_50:59:22194:-1 gene:ENSOPRG00000005348 transcript:ENSOPRT00000005411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KISALEEGTFNLFLSEINLSGNPFECGCGLAWLPRWLEEQQVRVVQPEAATCAGPAPLAG
QPLLSIPLLDSGCGEKYVACLPDNSSGIVATAAFTALGGQLGPETCSAFCFSTGWELAAL
SEQGECLCGAPQPLNTSLACLSLCSSPPPSPSPACGGPSLLQHVFPASPGAVLEGPRGPL
ASGWPAAFHIAAPLPIQSTHWDFGDGSPKTDTAGSATTHRYLLPGHYHVTALLALGAGSA
VLDTEVWVEAAPAALGLVCPPLVRSNESLQLGVQNRGGSGLEATYSIMALGEEPAQVVHP
LCASDTEIFSGNGHCYRLVAEKAPWLQAQEQCRAWAGAALAMVDSPAVQHFLVSQVTRSL
YVWIVFSAAEGAELRAPQGSVFSLKSCQNWLPGEPHPATAEHCVRLGPAGQCNTDLCSAP
HSYVCELRPGGPVWDAENFLVGVPRGEIQGPPRLLASQSMLQVPREPVEVMVFPGLHLHR
EAFLTAAEFETLELRQPAQLRLQVYRPSGAEGASGNSTEPEGRSLENKFQPATEGLSQGC
SCPGVKCLSRDCANRSASGLWRPAAAYVLWREFLLAVPAGPPAYYSVSFSDQDAPMLPGD
LVGLQHDAGPGAFLHCPLAPSHPGLEARYLSSNSSAWLAHLPTKLQDSPAGRTCALWLLA
ATEQLTPLLGLTPNPGLPRPGRYKVQATVGNSVSRHNLSCSFDVVSPVTGLRVTYPATQD
GQLYIPTGGSVLLLQVDSGANATATARWTGGNVSAPFMATCPAATAALVPACAQETSDTL
FAVLVLPALREGEHTVEVVAENSASHANLSLRVTAEEPIRGLHASPSPENRVLQGVLVRY
SPVVEAGSDVTFRWTIDDKQSLTFHNMVFNVIYQSAAIFKLSLTASNHVSNATVDYNVTV
ERMNRMCGLQVSAVPAVLSPNTTLELTASVLVDSAMDVTFQTFGDGQQVAGQFKPPYDEF
FPDPDPTVAQVLVQHSTTHVYTSPGEYNLTVLVSNTFENLTQQVPVSVRSTLPSVALCVS
SSVLVAGRLVTFLPCPLPSPGGILYTWDLGDGSPALTQSQPAVSHTYAHGGSYRVRLELN
NTVSSVEACADVLVLHEPRGLSVLVSPAVEQGAPVLVSATLEAGDNITWTFDMGDGTVFS
GPEAKVQHVYLRAQNYTVTVRAASPAGYLAQSVHVQVFVLEVLRIEPSGCIPTQPGVQLT
AHVTGDPAHYLFDWTFGDGSSNRSIWGHPTVTHNFTRSGTFPLVLVLSSHVNKAHYFTSV
CVEPELGNVTLRPQQQFVRLGDEARLVAHVWPSFPYRYTWDSGTQDASPARTGGPEATFT
FREPGSYLVTVCVSNNVSAANDSALVEVQEPVVVTGIRVNSSRVLEPQKPYLLAAVGRGR
PASYQWELGDGAWLEGPAVVHSYNSTGDFTVRVVGWNEVSRSESQLNVTVKQRVRGLRVN
ASRTVVPLNGSVSFSTTLEAGSDARYSWVLCDRCTSIPGGPAISYTFRSVGTFTITVTAE
NEAGAAQDSVLIYVQELIEGLEVLGGGDACCFPTNHTLQLQASVREGTNISFSWNAQSEG
GLPLTGSGKGFALTALQAGTYHILLRATNMLGSALANRTVDFVEPVGWLTVAASPNPAAV
NTCVTLRAELASGSGITYTWSLGEELSWETPVPSSTHTFPTSGLYQVTVTAWNQLGAANA
TVEVAVQVPVSGLTIKAGDLDSSFVAVGSTVPFSGQLAAGTNVTWCWDVPGGSRYGQHVA
VGFPAASTFSIKLNASNAVSWLVAVHNLTVEESIVGLVLWASSEVAAPRQPVHFQILLAA
GSAVTFRLLVDGVGPEVLPGPYFSRSFSWVGDHVVSVQANNHVSRTQAQVRVSVLEPVAG
LQVPHCCEPGIPTGTEQNFTARVRQGSRVAYAWYFSLQKVQGDSLVILSGRDVTYTPVAA
GLLEIHVRAFNALGGVNLTLALEVQDVIQYVELRRGHCFTNRSAHFEAATSPSPRRVAYR
WDFGDGAPVQDTGEPWADHSYLQPGDYRVEVNASNLVSFFVAQATVSVQVLACEEPEVDV
ALPLQVLMRRSQRNYLEAHVDLRDCVIYQTEYRWEVYRAASCQRLAHSARVTLPGVDVSR
PQLVVPRLALPVGHYCFVFVVSFGDTPLARSIQANVTVAAERLVPIIEGGSYRVWSDTQD
LVLNGSESYDPNLEDGEQTPLSCHWACVASTQREAGVCTLNFGPRGSSVVTIPRDRLEAG
VEYTFSLTVWKAGRKEEVTSQTVLIRSGRVPIVSLECVSCKARAVYGVSRSSHVYLEGRC
HNCSRGSKRGRWAARTFSNKTLVLDKTTTSTGNAGMRLVVRRGVLRDGEGYTFTLTVLGR
SGEEEGCASIRLAPNRPPLGGACRLFPLEAVRALTTKVHFECTGWWDAEDAGAPLVYALL
LRRCRQGHCEEFWIYKGSLAAYSAVLPPGFRPHFQVGLAVVVQDQLGAAVVALNRSLVCA
VPEPNGSSPSLTAWLHGLTASVLPGLLRQADPQHVIEYSLALVTVLNEYEQVLDAAAEAE
QEQQLRAQMRKNITETLVSLRVNTVDDIQQITAALAQCTVSSRELVCRSCLKKTLHKLEG
MMRILQAETTEGTVTPMGIADSILNITGDLIHLAGLDLRAQLAEPGTEPAALMVASRAYN
LSSALMCILMRSRVLNEEPLTLVGEEIVAQGKRSDPLSLLCYGNASGPGCHFSIPEAFSG
ALAPLSDVVQLMLLVDSNPFPFGYISNYTVSTKVASMAFQTQAGTHIPIERLASERAITV
KVPNNSDQASWGPQASAGSAIIQPQASVSAVVALGSSNPAAGLHLQLTYTLVNGHYLSEE
PEPYLAVYLHSEPRPNEHNCSASRRISPELLTGSDHRPYTFFIAPGTRDPGTYYLNLTSH
FRWSALEVSVGIYTALCQYFSEEDMMWKTEGLMPLEETSPSQAVCLTRHLTAFGASLFVP
PSRVHFILPDPAAGMNYITLLTCAVCLGGYAVMAVILRKLDQLDLRHIRVIPFCGKRGRF
KYEIVVKTGWGRGSGTTAHVGIMLYGADSRSGHRHLHGHRAFHRNSLDIFQIATPHSLGS
VWKIRVWHDNKGLSPAWFLQHVIVRDLQSARSTFFPVNDWLSVDTEANGGLVEKEVLAAS
DAALWQFRRLLVAELQRGFFDKHIWLSVWDRRPRSRFTRVQRATCCVLLLCLFLGANAVW
YGVVGDATYSTGPVSRVVPLSLGTAAVGLVSSVIVYPVYLLILFLFRMSQSKVARGLGHA
PPGPPELDGDSCMDSSVLDGAFLSLAGLRAEQAFAGHTKSDSFLEDSNSLACWPSSEGTF
SWPDLLSDPSIVGSTLQRLARVRMGRLLGAEEDGVSLASPCSPAKYLSALDEDLIRQVLA
DGGSGLTSQDPEMETDLLTGLSGAPGEKTEVLALQRLQGTPSAPAAPLCRAXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXHHRNPANPELKSPPARQVRLRELCPEGPGAGPRACSASGSYSIGDYSVGWGRE
THNGSAPWAYSAPDLPGTWSWGHCAVYDSGGYVQELVPTLEESRARLRFLRRNNWLDD
Download sequence
Identical sequences ENSOPRP00000004969 ENSOPRP00000004969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]