SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004991 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004991
Domain Number 1 Region: 531-563,643-717
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.92e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004991   Gene: ENSOPRG00000005425   Transcript: ENSOPRT00000005437
Sequence length 772
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5412:855368:929697:1 gene:ENSOPRG00000005425 transcript:ENSOPRT00000005437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPGDKSEPPQLPEYHCSYVISRPVYSELAFQQKHERRLQERRTLRESLAKSCSCSRKK
FGILKTLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMAYALLAAVPVGYGLYSAF
FPILTYFIFGTSRHLSAGPFPVVSLMVGSVVLSMAPDEDFLIPMNGTASNITVVDSAARD
AARVLVASALTLLVGIIQLIFGCLQIGFIVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXTLIEIFENIGDTNIADFIAGLLTIVICMAVKELNDRYKHKIPIPIPI
EVIVTIIATAISYGANLEKNYNAGIVKSIPRGFLPPALPPVSLFSGMLAESFSVAVVAYA
IAVSVGKVYATKHDYTIDGNQEFVAFGISNIFSGCFSCFVATTALSRTAVQESTGGKTQV
AGIISTVVMIAIVALRKLLEPLQKSVLAAVVIANLKGMFMQVCDVPRLWRQNKTDADIEN
SCTVAIILDLGLRAAFKXALLTVVRVQFPSWNGLGSIPSTDIYKSTKDYKNIEEPEGVKI
LRFSSPIFYGNVDGFKKCIKSTVGFDAIRVYNKRLKALRIIQKLIKKGQLRATKNGIISD
GLPNNAFEPDEDTEDFEELDVPTKEIEVQVDWNSELPIKVNVPKVPIHSLVLDCGAISFL
DVVGVRSLKMIVKEFQRIDVNVYFASLQDHVLEKLEQCGFFDDHMGKDTFFLTVHDAILY
LQNQGKSQEGQDSILEKITLIQDCKDPLELMEAELVEEEFDVQDEAIRRLAS
Download sequence
Identical sequences ENSOPRP00000004991 ENSOPRP00000004991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]