SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005020 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005020
Domain Number 1 Region: 28-334
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 5.19e-101
Family (Glycosyl)asparaginase 0.000000000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005020   Gene: ENSOPRG00000005475   Transcript: ENSOPRT00000005468
Sequence length 346
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1158:189693:200329:-1 gene:ENSOPRG00000005475 transcript:ENSOPRT00000005468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKWMRPLIVVQLLLGPAPVRSGGLLPLVLNTWPFKNATEAAWRALASGGSALDAVESG
CGECEEEQCDGTVGFGGSPDELGETTLDAMIMDGTAMNVGAVGDLRRIKNAIGVARKVLE
HTTHTFLVGESATKFAESMGFANEDLSTSVSRALHSDWHARNCQPNYWRNVIPDPSKSCG
PYKPSRISKQEASTCKDPGADCGHDTIGMIVIHKKGYTAAGTSTNGIKFKIPGRVGDSPI
PGAGAYADDTAGAAAATGDGDILMRFLPSYQAVEYMRKGEDPTTACQKVISRIQKHFPKF
FGAVICANVTGSYGAACNKLPTFAQFHFMVYNPLKNHPAEEKVDCI
Download sequence
Identical sequences ENSOPRP00000005020 ENSOPRP00000005020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]