SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005036 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005036
Domain Number 1 Region: 143-255
Classification Level Classification E-value
Superfamily C-type lectin-like 8.47e-38
Family Link domain 0.0013
Further Details:      
 
Domain Number 2 Region: 257-340
Classification Level Classification E-value
Superfamily C-type lectin-like 3.91e-23
Family Link domain 0.002
Further Details:      
 
Domain Number 3 Region: 45-148
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000497
Family V set domains (antibody variable domain-like) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005036   Gene: ENSOPRG00000005492   Transcript: ENSOPRT00000005484
Sequence length 342
Comment pep:known_by_projection scaffold:pika:scaffold_39127:1539:3260:1 gene:ENSOPRG00000005492 transcript:ENSOPRT00000005484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGQLTLLALCRFLLPWILATIVHKALGDPAPHPGPHYLLSPIHEVIHSRRGATATLPCV
LGASPPSYKVRWSKVEPGELRETVILITNGLHARGYGPLGDRARMRRGHRLDASLVIADV
RLEDEGRYRCELINGIEDESVALTLRLEGVVFPYQPSRGRYQFNYYEAKQACEEQDGRLA
TYAQLYQAWTEGLDWCNAGWLLEGSVRYPVLTARAPCGGRGRPGIRSYGPRDRKRDHYDA
FCFTSALAGQVFFVPGRLTLSEAHAACRRRGAVVAKVGHLYAAWKFSGLDQCDGGWLADG
SVRFPITAPRPRCGGLPDPGVRSFGFPRPQQAAYGTYCYAEK
Download sequence
Identical sequences ENSOPRP00000005036 ENSOPRP00000005036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]